SecReT6
Protein ID: 73539094
SecReT6 ID89
T6SS typei2
Gene symbol-
Locus tagReut_B5271
StrainRalstonia eutropha JMP134
Repliconchromosome II [GenBank: NC_007348] [Browse all T6SS(s) in this replicon]
Location [Strand]2025768..2029238 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ46QG7
KEGG IDreu:Reut_B5271
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.40E-67, Aligned region: 94..113
IcmF-related [PF06761], Evalue: 1.40E-67, Aligned region: 399..720
DUF1215 [PF06744], Evalue: 3.30E-35, Aligned region: 840..963
Protein Sequence: 1156 a.a.     [Download]
>gi|73539094|ref|YP_299461.1| unnamed protein product [Ralstonia eutropha JMP134]
MKKLRIDLLSLLVLALLITCAIVIWGESLGIKTPDARSLWLSLVAFGTLILAVLASLDRFARAWDAVRAL
TMSLRRREPELADTTQASLLKSRLTQRAPKDLDDLRSELRQRYGLRWRYRLPWLLLIGDDAAIAQRLPDL
DEQGWLITPHAVLVRSKLETARLKQLSKLRRRRPIDLVVLVLDGATTPLKERYGTHAFSIALARVAESLR
WSAPIHALEIVHASSISPADMPVIACEVSRQANSSGIEAALHALRDQLSEQSLERLPQNGREIYLGQLSQ
WLDGRAKALANWLGELEGGTRRKLPVRGFAFAPAFDDREYLDAIAELPLWQHLGDTARRQPGRRIGFHPV
TVLTVLALSAISLWIGGMFLSGLQNARDLQAAQQAAHEIQSTPSTAARLQALDTLQQQIQRYEDRVQHHA
PLFTRFGLNRDADVLAALWKPYAKASRDILVAPAAQDLEAKLVDLSQLQTSGLNEETSKWALQGHDTLKA
YLMLAHPERVDAAFLAQQLGQHWTTDARIPPGQKQDLAERFARFYAEHLKANPDWRIEPRPELVTGARQT
LLAVIGERNAQDTIYQGILRGAGNKYPDQTLASLTAGTDPRGLLRAVALVPGVFTRQAYEGYVAAAIEEA
AKRKQVASDWVLTGGKPPQPDADADSGKDLQAALTEQYFDEYADHWQQFMNSAQWEPAATLPAVIDQLKL
LADARQSPVIALMKSLEYQGGAGARKDSLSDTLVNKARDLIGKKIEVPEVAKADPAGPLGIAFGPVLRLV
GQGGQGLQGNQGDLSLQRYLDRATALRLRLQQISTSSDGDAQARQMAQALFQGKGSELADTQAYAQLMAA
SFGNQWAGMGDALFVRPIAQATQVVLLPAQASLDDAWRQNIAMAWGRSFAGRYPFADTANDASLPELARF
LRPQSGLIHAFLATNLAGVLELQGDQWVPSATAGQAMAFDPAFLKGINTLQHIAAHLLAQGEPAYRFQLK
PIPTPGLTDSLLTVDNQKLHYYNQRETWQFMTWPASNLQEPGTRLQWQTEKAGTNKNYEFSGPWGWVRML
ERARVMPIDTATFQLTWQASADTGDQKAGAGTGEPGAAVQPDAAALIARDAKRPASADLAYPISYQLRTD
VSQGPLEMLWLRGFVLPSRIFAGKEPAGRMAPSTRK
 
Nucleotide Sequence: 3471 bp     [Download]
>gi|73537298|ref|NC_007348.1|:2025768-2029238 Ralstonia eutropha JMP134 chromosome 2, complete sequence
ATGAAGAAGCTACGGATAGATTTGCTTTCCCTCCTTGTGCTTGCGCTCCTGATCACTTGCGCTATCGTGA
TTTGGGGAGAAAGTCTCGGCATCAAGACCCCCGATGCTCGGAGCCTTTGGCTTTCCTTGGTGGCTTTCGG
CACGCTCATTCTCGCTGTGCTTGCGTCATTGGATCGTTTTGCGCGCGCGTGGGATGCGGTGCGTGCGCTG
ACTATGTCGCTTCGCCGCCGTGAACCTGAGTTGGCCGATACTACACAAGCGAGCCTACTGAAGTCCCGCC
TCACGCAACGAGCACCGAAGGATCTTGACGATTTACGTAGTGAGTTGCGACAGCGGTACGGCCTACGTTG
GCGCTATCGTCTGCCTTGGCTGCTGTTGATCGGCGACGATGCCGCCATCGCGCAACGGCTACCTGACCTG
GATGAACAGGGCTGGCTAATCACTCCGCATGCTGTACTGGTTCGCAGCAAATTGGAGACGGCTCGACTCA
AACAACTCTCGAAACTGCGCCGTCGGCGCCCTATCGACTTGGTTGTGCTGGTCTTGGACGGGGCGACAAC
CCCGCTCAAGGAACGTTATGGCACGCATGCTTTTTCCATCGCCCTTGCGCGCGTTGCTGAGAGTTTGCGC
TGGTCTGCTCCGATTCATGCGCTCGAAATTGTTCACGCAAGTTCCATTTCGCCCGCCGATATGCCAGTCA
TTGCCTGTGAGGTGTCCCGGCAAGCGAACTCCAGTGGAATCGAGGCCGCGCTACATGCGCTACGTGATCA
ACTATCGGAACAGAGTTTGGAACGACTCCCCCAGAATGGCCGGGAGATTTATCTGGGACAGCTTTCCCAA
TGGCTGGATGGCCGCGCCAAGGCACTGGCCAATTGGCTTGGCGAATTGGAGGGCGGTACCCGCAGGAAGT
TGCCGGTTCGCGGTTTCGCCTTTGCGCCGGCGTTTGATGATAGGGAATACCTCGACGCCATTGCGGAATT
GCCGCTGTGGCAACATTTAGGCGATACCGCACGGCGACAGCCGGGGCGTCGTATAGGCTTTCATCCCGTG
ACGGTGCTTACGGTATTGGCTCTGTCCGCTATCAGCTTGTGGATTGGGGGCATGTTTCTGTCCGGTCTCC
AGAACGCGCGAGACCTGCAGGCCGCACAGCAGGCCGCGCACGAGATCCAATCTACGCCCAGTACCGCCGC
ACGCCTGCAGGCGCTCGATACCCTGCAACAGCAAATCCAGCGCTACGAGGACCGCGTCCAACACCACGCG
CCGCTCTTCACCCGCTTCGGCCTGAACCGCGATGCCGACGTACTGGCCGCGCTGTGGAAGCCTTACGCAA
AGGCCAGCCGCGACATCCTTGTCGCTCCGGCGGCACAGGACCTGGAAGCGAAACTGGTCGACCTGTCGCA
ACTGCAGACCAGCGGACTGAATGAAGAAACCAGCAAGTGGGCACTGCAGGGACACGACACCCTCAAGGCC
TACCTCATGCTCGCCCACCCGGAGCGAGTGGATGCTGCATTCCTCGCGCAGCAACTGGGGCAGCACTGGA
CCACCGACGCGAGGATTCCCCCTGGACAGAAGCAGGACCTGGCCGAGCGGTTCGCCAGGTTCTACGCCGA
GCACCTGAAGGCCAACCCGGACTGGCGCATCGAGCCCCGTCCAGAGCTGGTGACCGGTGCACGGCAGACC
CTGCTAGCGGTGATCGGGGAGCGCAATGCGCAGGACACCATTTATCAGGGCATCCTCCGCGGCGCTGGCA
ACAAATACCCCGACCAGACCCTGGCCTCCCTGACCGCCGGCACGGACCCGCGCGGGTTGCTGCGCGCTGT
CGCGCTGGTGCCCGGCGTCTTCACCCGGCAGGCCTATGAGGGTTACGTAGCTGCAGCCATTGAGGAAGCC
GCCAAGCGCAAGCAGGTCGCCAGCGACTGGGTGCTGACGGGAGGCAAGCCGCCACAGCCGGATGCCGACG
CAGATTCCGGCAAGGACCTGCAGGCCGCCCTGACCGAGCAGTACTTCGACGAGTACGCCGACCATTGGCA
GCAGTTCATGAACAGCGCGCAATGGGAGCCAGCGGCGACGCTACCTGCCGTTATCGACCAGCTCAAGCTC
CTGGCCGACGCGCGCCAGTCGCCGGTGATCGCGCTGATGAAGTCGCTGGAGTACCAGGGTGGCGCCGGGG
CGCGCAAGGATTCGCTGTCGGACACGCTGGTCAACAAGGCCCGCGACCTGATCGGCAAGAAGATCGAGGT
ACCGGAGGTCGCCAAGGCCGACCCTGCCGGCCCGCTCGGGATCGCGTTCGGTCCAGTGCTGCGGCTGGTG
GGCCAGGGCGGCCAGGGCCTCCAAGGCAATCAGGGCGACCTGAGTCTGCAACGTTATCTCGATCGCGCGA
CGGCCTTGCGGCTGCGCCTGCAGCAGATCAGCACCAGTAGTGATGGCGATGCCCAGGCGCGCCAGATGGC
CCAAGCCTTGTTTCAAGGCAAAGGCTCGGAGTTGGCCGATACCCAGGCCTATGCACAGCTGATGGCGGCC
AGCTTCGGTAACCAATGGGCCGGCATGGGAGACGCCCTGTTCGTGCGCCCGATCGCGCAGGCCACTCAGG
TGGTCCTGCTGCCCGCCCAGGCAAGCCTGGATGATGCATGGCGCCAGAACATTGCGATGGCGTGGGGCCG
GTCGTTTGCAGGACGCTACCCGTTCGCCGACACCGCCAATGACGCCTCGCTGCCGGAACTGGCGCGCTTC
CTGCGCCCGCAAAGCGGTCTGATCCACGCATTTCTGGCAACGAACCTTGCTGGCGTGCTCGAGTTGCAGG
GGGATCAATGGGTACCCTCGGCCACCGCAGGACAGGCCATGGCCTTCGATCCCGCCTTTCTCAAGGGCAT
CAATACGCTGCAGCATATTGCCGCCCACCTGCTGGCGCAGGGCGAGCCCGCGTATCGCTTCCAGCTCAAG
CCGATTCCGACGCCCGGCCTGACGGACTCGCTGCTGACCGTGGATAACCAGAAACTGCACTACTACAACC
AGCGCGAGACCTGGCAGTTCATGACGTGGCCGGCCAGCAACCTGCAGGAGCCCGGCACCAGGCTGCAATG
GCAAACCGAGAAGGCCGGCACCAACAAGAACTACGAGTTCAGCGGGCCTTGGGGCTGGGTGCGGATGCTG
GAGCGCGCGCGCGTCATGCCAATCGACACTGCGACGTTTCAGCTGACCTGGCAAGCCAGCGCGGACACTG
GGGACCAAAAGGCGGGCGCTGGCACGGGCGAGCCCGGTGCTGCCGTACAACCCGACGCCGCTGCCCTCAT
TGCACGCGATGCAAAGCGGCCAGCGTCGGCGGACCTTGCCTATCCGATCAGCTATCAGTTGCGCACAGAC
GTGAGTCAGGGTCCGCTGGAAATGCTATGGCTGCGCGGATTCGTGCTCCCGTCCCGCATCTTCGCCGGCA
AGGAACCTGCCGGACGCATGGCACCGTCAACACGCAAGTAG
 Primer design