SecReT6
Protein ID: 73541404
SecReT6 ID88
T6SS typei4a
Gene symbol-
Locus tagReut_A1715
StrainRalstonia eutropha JMP134
Repliconchromosome I [GenBank: NC_007347] [Browse all T6SS(s) in this replicon]
Location [Strand]1850094..1854242 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ470V3
KEGG IDreu:Reut_A1715
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.90E-42, Aligned region: 138..416
Protein Sequence: 1382 a.a.     [Download]
>gi|73541404|ref|YP_295924.1| unnamed protein product [Ralstonia eutropha JMP134]
MLTSNLFLISIGVLTLVAFAVLGLVLYYAAQGGRAKPAGERKIVRLRTDTLRAAFRQAIELIEGNLVSRA
ERYNIPWIMVLNEGDDARPLPIAQSGVSSALGTDAANAAATQGISWHFFDRGVVIDINAGYLGSPDDDGD
EKPWDEFLGLCRNYRPQRPFDSVVITVPAAKLLADDTDAQLELVRRAKLVHRRLWLAQNRFAVRFAVYVV
VTGAEALPGFAQFARDLPEPMRASMLGWSSPYDLSATYQSDWVEAALSSIVRSVSDSAAELLAAAPPDLD
ARQLLLLPARIEAMRAQLQRYIDELLRPSAYHEPFFFRGVYLTGDSGELAAQGLSAVPRGETEPEREDSE
SLPERIEPVLDAGESSVAGGTHLTELMLQPAFLRDLFDKKIFLEYGLTRPSRSQHLARPVVHRALRWGGV
ALLGLWGVGLAVNTWQLGQRKAELLAALGGLRNASQQRAQAEQAGQELPPEWYRRQTLGLIDMNQRLMAQ
STWSVFMPGSWSPFDDLDERMREHFQREFGKVALPTIHREMLARVSQLTGVVRDPSTAELVIGDDCAVPA
GARGDAGGPRTLAIEDLPEMRALQQYVGAVDQFDAALSALQRLENGGEGRSEALRTVVRYALGAELHGDV
SGTLSYFRTDGGAGRGAHAMVGSAPAVGPAQVVQPLRCSYDKGARQLEARLFSDNALLVAERSVRDGLEA
LSGAGTDFSHVLGDYRGIVAGIGTQQELLAGGKAGWLRQPQFAPGPAYERLLAQATRSRLLGEDLVARQR
ERSRAGFAALREELAQRFSGPEAGIVWQDKEGRYAVAPERLALRDRLAALVSQPFMTAPRDLPLPALGAR
TVVNWDRQQLDQAMTLAETRKRFVGEGLADLPGASRDTVARSIDAQFTRLMMDQVAAAAVVAPAGAAGSA
GSTGSDSAAFEAALGRLVKIKTALAEMHATARVEDLDALISRDALAHLRAVDEALQQSELYAIRQSGGDA
RSRSPMLAAFGLSDAAGLGPYLDQQSGRALALGREASLYLGVLNSGDAASPLAQRWLAITRDLERYRLKN
PNSQLLMLEQFIQGMAADGGRGGCFGRFASRLPRGADDYFATLQARVYEGLLARCAQGYFAELQRQWDGF
SAIFNERVAGHAPFGAAVQGGPNPADQTMADYGELGRVLKRYEQVSTVYREPRGDGPLKGLSAGMPVHQF
MDNFEQVRTLLSPLYPADDSTPGGYDINVDFRVNRSAELAGNQIIDWSLSVGAQNLSQQEAPRSLRWEYG
MPVMLTLRFAKDSPLQATADPRQRALSTDGRSMTWRFADPWALISFIGRQRVADPSVRAEGAASLLRFDF
PLAPATPADLTAVPKQGQGRVFLRLALTPAGKKTPLPWPRSFPTRAPDWNPL
 
Nucleotide Sequence: 4149 bp     [Download]
>gi|73539706|ref|NC_007347.1|:c1854242-1850094 Ralstonia eutropha JMP134 chromosome 1, complete sequence
ATGCTGACCAGTAATCTCTTCCTGATCTCGATCGGCGTGCTGACGCTGGTCGCATTCGCCGTGCTTGGCC
TGGTGCTGTACTACGCGGCGCAGGGCGGTCGCGCCAAGCCCGCCGGCGAGCGCAAGATCGTGCGGCTGCG
CACCGATACGCTGCGCGCGGCGTTTCGCCAGGCGATCGAGCTGATCGAGGGGAATCTCGTTTCGCGCGCA
GAGCGCTACAACATTCCCTGGATCATGGTGCTCAACGAGGGCGACGATGCCCGGCCGTTGCCGATCGCCC
AGTCGGGCGTGTCCAGCGCGCTTGGTACCGACGCCGCCAATGCGGCCGCCACCCAGGGCATCTCGTGGCA
CTTCTTCGACCGTGGCGTGGTGATCGACATCAACGCCGGCTACCTCGGTTCGCCCGACGATGATGGCGAT
GAAAAGCCCTGGGACGAGTTCCTGGGGCTGTGCCGCAACTACCGTCCGCAGCGCCCCTTCGACAGCGTGG
TGATAACGGTGCCGGCGGCGAAGCTGCTGGCGGACGACACCGACGCGCAGCTCGAACTGGTGCGGCGCGC
CAAGCTCGTGCACCGGCGTCTGTGGCTCGCGCAGAACCGCTTCGCGGTGCGCTTTGCCGTATACGTGGTG
GTGACCGGCGCCGAAGCGCTGCCGGGGTTCGCCCAGTTCGCGCGGGACCTGCCCGAGCCGATGCGAGCCA
GCATGCTGGGCTGGTCCTCGCCCTACGACCTGTCCGCCACCTACCAGTCGGACTGGGTCGAGGCTGCCTT
GTCGTCGATTGTGCGCAGCGTGTCCGACAGCGCCGCCGAGTTGCTGGCGGCGGCGCCGCCCGACCTCGAC
GCGCGCCAGTTGCTGCTGCTGCCAGCCCGCATCGAGGCGATGCGCGCGCAGCTGCAGCGCTATATCGACG
AGCTGCTGCGCCCGAGCGCCTATCACGAGCCGTTCTTCTTTCGAGGCGTCTACCTGACCGGCGACAGCGG
CGAGCTGGCGGCGCAGGGCCTGAGCGCGGTGCCGCGCGGTGAGACGGAGCCGGAACGCGAAGACAGCGAG
AGCCTGCCGGAGCGCATTGAGCCGGTGCTGGACGCCGGCGAAAGCAGTGTCGCTGGTGGCACGCATTTGA
CCGAGCTGATGCTGCAGCCGGCCTTCCTGCGCGACCTGTTCGACAAGAAGATATTCCTGGAATACGGCCT
GACCCGGCCTTCGCGCTCGCAGCATCTGGCCCGCCCGGTGGTGCACCGCGCGCTGCGCTGGGGCGGCGTG
GCGCTGTTGGGGTTGTGGGGTGTCGGTCTGGCGGTGAACACCTGGCAGCTCGGGCAACGCAAGGCGGAGC
TGCTGGCAGCGCTGGGTGGGCTGCGCAATGCCAGCCAGCAGCGTGCGCAGGCGGAGCAAGCCGGCCAGGA
GCTGCCGCCCGAGTGGTACCGGCGCCAGACGCTCGGCCTGATCGATATGAACCAGCGCCTGATGGCGCAG
TCGACCTGGTCCGTGTTCATGCCGGGTTCCTGGAGCCCGTTCGACGATCTGGACGAGCGCATGCGCGAGC
ATTTCCAGCGCGAATTCGGCAAGGTGGCACTCCCCACGATCCACCGCGAGATGCTGGCGCGCGTCAGCCA
GCTCACCGGTGTCGTGCGCGACCCCAGCACCGCCGAGCTGGTGATCGGCGACGACTGCGCGGTGCCCGCC
GGTGCGCGTGGTGACGCGGGCGGTCCGCGCACCCTCGCGATCGAAGACCTGCCCGAGATGCGCGCGCTGC
AGCAGTACGTGGGGGCGGTCGACCAGTTCGACGCCGCTCTGTCAGCGCTGCAGCGCCTGGAAAACGGCGG
GGAAGGGCGCAGCGAGGCGCTGCGCACGGTGGTGCGCTATGCGCTGGGCGCGGAACTGCATGGGGATGTC
TCCGGCACCTTGTCGTATTTCCGCACCGACGGCGGCGCCGGGCGCGGCGCACACGCCATGGTCGGCAGCG
CACCGGCTGTAGGCCCGGCGCAAGTGGTGCAGCCGCTGCGCTGCAGCTACGACAAGGGCGCGCGCCAACT
GGAGGCGCGCCTGTTCAGCGACAACGCCCTGCTGGTGGCGGAGCGATCGGTTCGGGACGGCCTGGAGGCG
CTGAGCGGCGCCGGCACGGACTTCAGCCATGTGCTGGGCGACTATCGCGGGATCGTGGCGGGCATTGGTA
CGCAACAGGAGTTGCTTGCGGGCGGCAAGGCCGGCTGGCTCCGGCAGCCGCAGTTCGCGCCCGGCCCGGC
CTACGAGCGCCTGCTGGCGCAGGCCACGCGCAGTCGCCTGCTGGGCGAGGATCTGGTGGCGCGCCAGCGC
GAGCGTTCGCGGGCCGGCTTCGCCGCGCTGCGCGAGGAACTGGCGCAACGCTTCAGCGGTCCCGAAGCGG
GCATCGTCTGGCAGGACAAGGAGGGCCGCTACGCGGTGGCGCCCGAACGGCTGGCGCTGCGCGACCGCCT
GGCCGCGCTGGTCAGCCAGCCCTTCATGACTGCGCCGCGTGACCTGCCGCTGCCCGCGCTCGGTGCGCGC
ACGGTGGTGAACTGGGACCGCCAGCAGCTCGACCAGGCCATGACCCTGGCCGAGACCCGCAAGCGTTTCG
TGGGCGAGGGCCTGGCCGACCTGCCGGGCGCCTCGCGCGATACGGTGGCGCGCAGCATCGACGCGCAGTT
CACGCGGCTGATGATGGACCAGGTGGCGGCAGCCGCGGTGGTCGCGCCGGCCGGCGCCGCGGGCAGCGCA
GGCAGCACGGGCAGCGACAGCGCCGCGTTCGAGGCCGCGCTGGGCCGGTTGGTGAAGATCAAGACCGCCC
TGGCCGAGATGCACGCCACGGCGCGCGTGGAAGATCTCGATGCGCTCATCTCGCGCGATGCGCTGGCGCA
TCTGCGCGCGGTTGACGAGGCCCTGCAACAGTCCGAACTCTATGCCATCCGCCAGTCCGGCGGCGATGCC
CGCAGCAGGTCGCCGATGCTGGCGGCGTTCGGCCTGAGCGATGCGGCCGGGCTCGGCCCCTACCTGGACC
AGCAGTCGGGACGCGCGCTGGCGTTGGGGCGCGAGGCCTCGCTTTACCTGGGCGTGCTCAATTCGGGCGA
TGCCGCCTCGCCGCTGGCGCAGCGCTGGCTGGCCATCACGCGCGACCTCGAACGCTACCGGCTGAAGAAC
CCGAACAGCCAGCTGCTGATGCTCGAGCAGTTCATCCAGGGAATGGCCGCCGATGGTGGCCGCGGGGGCT
GCTTTGGCCGCTTCGCCAGCCGCCTGCCGCGCGGTGCCGACGACTACTTCGCCACGCTCCAGGCACGTGT
CTACGAGGGCTTGCTGGCGCGTTGCGCGCAGGGGTACTTCGCCGAACTGCAGCGCCAGTGGGACGGCTTC
TCCGCGATCTTCAATGAACGCGTGGCAGGGCATGCGCCCTTTGGCGCGGCCGTGCAGGGCGGGCCCAACC
CGGCCGATCAGACCATGGCCGACTACGGCGAACTCGGTCGCGTGCTCAAGCGCTACGAGCAGGTCTCGAC
GGTCTATCGCGAGCCACGCGGCGACGGCCCGCTCAAGGGCCTGTCCGCTGGCATGCCGGTGCACCAGTTC
ATGGACAACTTCGAGCAAGTCCGGACACTGCTTTCCCCGCTGTATCCGGCGGATGACAGCACACCCGGCG
GCTACGACATCAACGTCGACTTCCGTGTCAATCGGAGTGCCGAACTGGCCGGCAACCAGATCATCGACTG
GAGCCTGAGCGTGGGCGCGCAGAACCTGTCTCAGCAGGAGGCTCCGCGCTCGCTGCGCTGGGAGTACGGC
ATGCCGGTGATGCTGACACTGCGCTTCGCCAAGGATTCGCCGCTGCAGGCCACGGCGGACCCGCGCCAGC
GCGCGTTGTCTACCGACGGCAGGTCGATGACCTGGCGCTTTGCCGATCCCTGGGCGCTCATTTCCTTTAT
CGGCCGCCAGCGGGTGGCGGATCCTTCGGTGCGCGCCGAGGGTGCCGCCTCGCTGCTGCGCTTCGATTTC
CCGCTGGCGCCGGCCACCCCGGCAGATTTGACTGCCGTGCCGAAGCAGGGGCAGGGCCGCGTGTTCCTGC
GCCTGGCGCTGACCCCCGCCGGCAAGAAGACGCCGCTGCCGTGGCCGCGCAGCTTCCCGACCCGTGCTCC
CGACTGGAACCCGCTGTGA
 Primer design