SecReT6
Protein ID: 74310835
SecReT6 ID90
T6SS typei1
Gene symbol-
Locus tagSSON_0235
StrainShigella sonnei Ss046
Repliconchromosome [GenBank: NC_007384] [Browse all T6SS(s) in this replicon]
Location [Strand]258034..258720 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ3Z5E3
KEGG IDssn:SSON_0235
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 1.20E-23, Aligned region: 2..87
Protein Sequence: 228 a.a.     [Download]
>gi|74310835|ref|YP_309254.1| hypothetical protein SSON_0235 [Shigella sonnei Ss046]
MEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLDAFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNN
VIIREDIIAQLETAQKIRDIFFSKQNGLGTSFAVETVSLSGNKRRSVLNLDSQLVDYSQGRNYTAHLVWP
NNMREGNESKLTLIGTSGNAPRSISFSGPWAQFRLFWAGQLTGVQDGNFTVRFSVDGGAMTYRVHTDTED
NPFSGGLFSQFGLSDTLY
 
Nucleotide Sequence: 687 bp     [Download]
>gi|74310614|ref|NC_007384.1|:c258720-258034 Shigella sonnei Ss046 chromosome, complete genome
ATGGAAGTGGACTGGCGCGACAGCGTGGTGAAACCGTTTAACGAGCAACTGGCAAATAACTATCCGTTTA
ATCCGCGTTCTGCACAGGATGCCTCACTGGATGCCTTCGAACGCTTCTTTAAACCGGATGGCATACTGGA
TACCTTCTACCAGCAGAACCTGAAGCTGTTTATCGATAATGACCTGAGTCTGGAGGATGGCGATAACAAC
GTCATTATTCGCGAAGATATTATTGCGCAACTGGAAACTGCGCAGAAAATCCGTGACATCTTCTTCAGCA
AACAGAACGGTCTGGGAACATCCTTTGCCGTGGAAACGGTATCGCTTTCAGGCAATAAACGCCGCAGTGT
ACTGAACCTTGACAGTCAGTTAGTCGATTACAGCCAGGGCCGTAACTATACCGCCCATCTGGTCTGGCCT
AACAACATGCGCGAAGGCAACGAAAGTAAGCTGACGCTCATCGGCACCAGCGGCAACGCGCCGCGCAGTA
TCAGCTTCAGCGGGCCGTGGGCGCAGTTCCGCCTGTTCTGGGCCGGACAACTGACCGGAGTACAGGATGG
CAACTTTACCGTGCGCTTTAGCGTGGACGGTGGCGCGATGACCTACCGTGTGCATACCGACACGGAAGAT
AACCCGTTCAGCGGTGGGTTGTTCAGCCAGTTTGGTCTGTCAGACACACTGTACTGA
 Primer design