SecReT6
Protein ID: 74310836
SecReT6 ID90
T6SS typei1
Gene symbol-
Locus tagSSON_0236
StrainShigella sonnei Ss046
Repliconchromosome [GenBank: NC_007384] [Browse all T6SS(s) in this replicon]
Location [Strand]258757..259932 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ3Z5E2
KEGG IDssn:SSON_0236
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.70E-73, Aligned region: 1..276
IcmF-related [PF06761], Evalue: 4.70E-73, Aligned region: 324..340
Protein Sequence: 391 a.a.     [Download]
>gi|74310836|ref|YP_309255.1| hypothetical protein SSON_0236 [Shigella sonnei Ss046]
MEQTYLQLLEQRYLPSLFNGLVKAMNAAPPESEEKLAVLRVMRMLEDKSGRNNQVVKQYMAKRWSEKFHG
QRDIQAQLMSHLDYALAHTDWHAERQAGDGDAISRWTPYDKPVVSAQKELSKLPVYQRVYQSLKTRALGV
LPADLNLRDQVGPTFDQVFTSADDNKLVVPQFITRYGLQSYFVKQRDELVELTAMDSWVLNLTRNVKYSD
ADRAEIQHQLTEQYISDYTATWRAGMDNLNIRNFESIGQLTGALEQVISGDQPLQRALTVLRDSTQPGVF
SEKLSAKEREEALAEPDYQLLTRLGHEFAPENSTLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGK
SALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWVGRLTD
 
Nucleotide Sequence: 1176 bp     [Download]
>gi|74310614|ref|NC_007384.1|:c259932-258757 Shigella sonnei Ss046 chromosome, complete genome
GTGGAACAGACCTATCTGCAACTGCTGGAGCAACGTTACCTGCCCTCGCTGTTTAACGGGCTGGTCAAAG
CGATGAACGCCGCGCCGCCGGAGAGTGAAGAAAAACTCGCGGTGCTGCGCGTGATGCGAATGCTGGAGGA
CAAAAGCGGACGTAACAATCAGGTGGTGAAGCAGTATATGGCAAAACGCTGGAGCGAAAAGTTCCACGGT
CAGCGCGATATCCAGGCACAACTGATGTCCCATCTTGACTACGCGCTGGCTCATACTGACTGGCACGCAG
AGCGTCAGGCGGGCGACGGTGACGCCATCAGCCGCTGGACGCCATATGACAAGCCCGTGGTATCAGCACA
GAAAGAACTGAGCAAACTGCCTGTCTACCAGCGGGTTTACCAGAGCCTGAAAACGCGGGCGCTGGGCGTT
CTTCCTGCCGACCTCAATCTGCGTGACCAGGTAGGGCCAACCTTTGACCAGGTGTTTACATCTGCCGATG
ACAACAAACTGGTTGTTCCACAGTTTATCACCCGCTACGGCCTGCAAAGCTATTTTGTAAAACAGCGCGA
TGAACTGGTTGAACTGACAGCGATGGATTCCTGGGTACTTAACCTCACCCGCAATGTGAAATACAGTGAC
GCCGACCGTGCGGAAATCCAGCACCAGTTGACCGAGCAGTATATCAGCGACTACACCGCCACCTGGCGGG
CTGGGATGGACAATCTGAATATCCGCAATTTTGAGTCCATCGGACAACTGACCGGGGCGCTGGAGCAGGT
TATCAGCGGCGACCAGCCTTTGCAGCGGGCGCTGACCGTGCTGCGTGACAGCACACAGCCAGGCGTCTTT
TCTGAAAAACTCTCTGCCAAAGAACGGGAGGAAGCCCTGGCAGAGCCGGATTACCAGTTACTCACCCGCC
TCGGGCATGAATTCGCCCCGGAAAACAGTACCCTGGCAGTACAGAAAGACAAAGAAAGCACGATGCAGGC
CGTGTATCAGCAACTCACCGAGTTGCACCGCTACCTGCTGGCAATCCAGAACGCGCCTGTACCAGGGAAA
TCGGCGCTGAAAGCCGTGCAGTTACGGCTTGATCAGAACAGCAGCGATCCGATATTCGCCACCCGCCAGA
TGGCAAAAACGCTGCCTGCTCCGCTCAACCGCTGGGTTGGCAGACTGACTGACTAG
 Primer design