SecReT6
Protein ID: 76808921
SecReT6 ID91
T6SS typei4b
Gene symbol-
Locus tagBURPS1710b_3647
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007434] [Browse all T6SS(s) in this replicon]
Location [Strand]3972422..3973036 [+]
Productlipoprotein
NoteTssJ
UniProt IDQ3JN41
KEGG IDbpm:BURPS1710b_3647
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.40E-37, Aligned region: 15..176
Protein Sequence: 204 a.a.     [Download]
>gi|76808921|ref|YP_335012.1| lipoprotein [Burkholderia pseudomallei 1710b]
MNPHVTRYALPLAACILLGGCAAAVPLLGSAGSAALQMVGVGKPDVPDSQKPPRNLGLTLYAAQNLNAAN
DNRPLALVVRLYALKDPTSFQQAPFDSFTDPTKEKTALGADLLSVREITLIPGQHYNATEKVSREAQAFG
VVALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTGGTVIPSQQGMPTQRLDLLSSVNCG
 
Nucleotide Sequence: 615 bp     [Download]
>gi|76808520|ref|NC_007434.1|:3972422-3973036 Burkholderia pseudomallei 1710b chromosome I, complete sequence
ATGAATCCGCATGTGACTCGTTACGCGCTGCCGCTCGCCGCCTGCATTCTGCTCGGCGGCTGCGCGGCCG
CCGTGCCGCTCCTCGGTTCGGCGGGCAGCGCCGCGCTGCAGATGGTGGGCGTCGGCAAACCCGACGTGCC
CGATTCGCAGAAGCCGCCGCGCAATCTCGGCCTCACGCTCTATGCGGCACAGAACCTCAACGCCGCGAAC
GACAACCGTCCGCTCGCGCTCGTCGTGCGCCTCTACGCGCTGAAAGATCCGACGTCGTTCCAGCAGGCGC
CGTTCGACAGCTTCACCGATCCGACGAAAGAAAAGACCGCGCTCGGCGCCGATCTGCTGAGCGTGCGCGA
AATCACGCTGATTCCGGGGCAGCACTACAACGCGACCGAAAAGGTGTCGCGCGAAGCGCAGGCATTCGGC
GTCGTCGCGCTCTTTCGCGATCCGGCGCTACAACGCTGGAAACTGACTTTCGATCCGGCGAAATCCGAGA
AATCCGGCATAATCATTGGCCTGCACAACTGCGCGATGACCGTGACGGGCGGCACCGTCATCCCTTCGCA
GCAAGGCATGCCGACGCAGCGGCTCGATTTGCTGTCGTCGGTGAACTGCGGGTGA
 Primer design