SecReT6
Protein ID: 76809082
SecReT6 ID91
T6SS typei4b
Gene symbolevpA
Locus tagBURPS1710b_3645
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007434] [Browse all T6SS(s) in this replicon]
Location [Strand]3970822..3971340 [-]
ProductEvpA protein
NoteTssB
UniProt IDQ3JN43
KEGG IDbpm:BURPS1710b_3645
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.10E-59, Aligned region: 11..164
Protein Sequence: 172 a.a.     [Download]
>gi|76809082|ref|YP_335010.1| EvpA protein [Burkholderia pseudomallei 1710b]
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEIKELPFVVGVVGDLAGQSEIEQPKLRDRKFVNIDRDNF
DDVMKAIEPRATFQVENRLSEAGGKFAVDLKFRSINDFNPDEVVGQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLSNTQQLEALKKSADGGDKQGE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|76808520|ref|NC_007434.1|:c3971340-3970822 Burkholderia pseudomallei 1710b chromosome I, complete sequence
ATGGCGAAGAAAGAAAGCATTCAAAAGCGCTTGCAGAAAGTGCGGCCGCCCCGCGTCCAGTTGACGTACG
AGGTCGAACGGGGCGATGCGATCGAGATCAAGGAGCTGCCGTTCGTCGTCGGGGTCGTCGGCGATCTGGC
GGGGCAGTCCGAAATCGAGCAGCCGAAGCTGCGCGATCGCAAGTTCGTCAACATCGACCGCGACAACTTC
GATGACGTGATGAAGGCGATCGAGCCGCGCGCGACGTTCCAGGTGGAGAACCGCCTGAGCGAGGCGGGCG
GCAAGTTCGCGGTCGACCTGAAGTTCCGCTCGATCAACGATTTCAATCCGGACGAAGTCGTCGGGCAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCGAAGCTCGCGGACCTGCGCAACAAACTGGCCGGCAAC
GACAAGCTCGAAGACCTGCTGAGCGAAGTGCTGTCGAACACGCAGCAGCTCGAAGCGCTGAAGAAGAGCG
CGGACGGCGGCGACAAGCAGGGCGAATGA
 Primer design