SecReT6
Protein ID: 76809643
SecReT6 ID91
T6SS typei4b
Gene symbol-
Locus tagBURPS1710b_3635
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007434] [Browse all T6SS(s) in this replicon]
Location [Strand]3960172..3961104 [+]
ProductOmpA family domain-containing protein
NoteTagL
UniProt IDQ3JN53, Q3JN53
KEGG IDbpm:BURPS1710b_3635
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.90E-25, Aligned region: 144..177
OmpA [PF00691], Evalue: 2.90E-25, Aligned region: 208..302
BON [PF04972], Evalue: 0.0031, Aligned region: 81..119
BON [PF04972], Evalue: 0.0031, Aligned region: 156..169
Protein Sequence: 310 a.a.     [Download]
>gi|76809643|ref|YP_335000.1| OmpA family domain-containing protein [Burkholderia pseudomallei 1710b]
MTKPRLPLLRARRFALAFAALALGGAARADNVGPATVTPIDAGGVPVKSVPLAAPVTAAPVAATAGAGAT
VSSPPPANATPGQVVAGGKVADEATKAAVLQRLRDTYGAANVVDQIEIGNVATPPNWSANVQKLIGPQLK
QISKGQLKIDGTQIDVKGEVHNEAQRQQLASDMANALNPTYTIKNGLRVSASEQGLLDQTLANRTIEFET
GSATLTPQGRAILDQMAGALAKMSSRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTT
TGVGPDQPIAPNDSADGRARNRRIEFRAGQ
 
Nucleotide Sequence: 933 bp     [Download]
>gi|76808520|ref|NC_007434.1|:3960172-3961104 Burkholderia pseudomallei 1710b chromosome I, complete sequence
ATGACGAAGCCCCGCCTGCCCCTGCTGCGCGCCCGCCGCTTCGCGCTCGCGTTCGCCGCGCTCGCGCTCG
GCGGCGCCGCGCGCGCCGACAACGTCGGCCCCGCCACCGTCACGCCGATCGACGCCGGCGGCGTGCCCGT
CAAATCGGTGCCGCTCGCCGCGCCCGTGACGGCCGCGCCGGTCGCCGCGACGGCCGGCGCGGGCGCGACC
GTGTCGTCGCCGCCGCCCGCGAACGCGACGCCGGGCCAGGTCGTCGCCGGCGGCAAGGTTGCCGACGAAG
CGACGAAGGCCGCCGTGCTGCAGCGCCTGCGCGACACGTACGGCGCCGCGAACGTCGTCGACCAGATCGA
AATCGGCAACGTCGCGACGCCGCCGAACTGGTCCGCGAACGTCCAGAAGCTGATCGGCCCGCAACTGAAA
CAGATCAGCAAAGGACAGCTGAAGATCGACGGCACGCAGATCGACGTGAAGGGCGAAGTGCACAACGAGG
CGCAGCGCCAGCAGCTCGCGAGCGACATGGCGAACGCGCTGAATCCGACCTACACGATCAAGAACGGGCT
GCGCGTGAGCGCGTCCGAGCAGGGCCTGCTCGACCAGACGCTCGCGAACCGCACGATCGAATTCGAAACC
GGCAGCGCGACGCTCACGCCGCAAGGCCGCGCGATTCTCGACCAGATGGCGGGCGCGCTCGCGAAGATGT
CGAGCCGAACGGTCGAGATCATCGGGCACACCGACAACTCGGGCAACCGCACGTCGAACATCGCGCTCAG
CCAGGCGCGCGCGGACGCGGTCAAGGGATATCTGGTGACGAAGGGCATCGCGTCGCAGCAACTGACGACG
ACGGGTGTCGGCCCCGATCAGCCGATCGCGCCGAACGATTCGGCCGACGGGCGCGCGCGCAATCGCCGGA
TCGAATTCCGCGCGGGACAGTAA
 Primer design