SecReT6
Protein ID: 76809706
SecReT6 ID91
T6SS typei4b
Gene symbol-
Locus tagBURPS1710b_3648
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007434] [Browse all T6SS(s) in this replicon]
Location [Strand]3973145..3974491 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ3JN40
KEGG IDbpm:BURPS1710b_3648
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-135, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|76809706|ref|YP_335013.1| hypothetical protein BURPS1710b_3648 [Burkholderia pseudomallei 1710b]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRFDRDALGSNVLRASELSLVFP
DGALYSAPQADELPPPIALDTLPEGINEFTFYLALHPLRETGSNYADDRDAGFVSRFVSEQASVADHFTD
AAEADITFLKTNVKLIAHSEPRDQLLSIPLVRVRRTATSGFEIDDGFVPPCLAIEASPILHQRLRQLIDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTASAAFAALAHLHQHSALHPERLFQELLRLAGQLMT
FSKGYVLADLPAYRHDDPGPGFARLDSILRELLETVISTRYFAITLEEVRPSFHVGRLDSGKIDDKTAFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLAYTPQVPPAIPVRPGACYFALDARSPLYE
RMLQAQSAMIYAPSGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|76808520|ref|NC_007434.1|:3973145-3974491 Burkholderia pseudomallei 1710b chromosome I, complete sequence
ATGAGTTATTCGGCCAAGGTGCTCTGGGGAGAAGGCCTCTTTCTGAGGCCGCAGCACTTTCAGCGGCAGG
ACGCGTATCACGAAGCGCGCCTGTTCGAATCGATCCAGGCGATCCAGCCGTACAACTGGGGCGTGCGTTC
GGTGCGGTTCGATCGCGACGCGCTCGGCAGCAACGTGCTGCGCGCGAGCGAACTGTCGCTCGTGTTTCCG
GACGGCGCGCTCTACTCCGCGCCGCAAGCCGACGAACTGCCGCCGCCCATCGCGCTCGACACGCTGCCCG
AAGGCATCAACGAATTCACGTTCTACCTCGCGCTGCACCCGCTGCGCGAGACCGGCTCGAACTACGCGGA
CGACCGCGACGCCGGCTTCGTGTCGCGCTTCGTCAGCGAACAGGCGAGCGTTGCCGATCACTTCACCGAC
GCCGCGGAAGCGGACATCACGTTCCTGAAGACGAACGTGAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGTTGCTGTCGATCCCGCTCGTACGCGTGCGCCGCACCGCGACGTCCGGCTTCGAGATCGACGACGGCTT
CGTGCCGCCGTGCCTCGCGATCGAGGCGTCGCCGATCCTGCATCAGCGCCTGCGCCAGTTGATCGACGCG
CTGCAGGCGAAGGTGAATGCACTGTACGGTTTCCATCGCGAGCCGACGAAGAACATCATCGAGTTCCGCT
CGGGCGACATCGCATCGTTCTGGCTGCTGCACACGGCGAGCGCCGCGTTCGCCGCGCTCGCGCACCTGCA
CCAGCATTCGGCCTTGCATCCGGAACGGCTGTTCCAGGAACTACTGCGCCTCGCGGGCCAGTTGATGACG
TTCTCGAAGGGCTACGTGCTCGCCGATCTGCCCGCGTACCGGCATGACGATCCGGGCCCGGGCTTCGCGC
GGCTCGATTCGATCCTGCGCGAGCTGCTCGAGACCGTGATCTCGACGCGCTACTTCGCGATCACGCTCGA
GGAAGTGCGGCCGTCGTTCCATGTCGGGCGGCTCGACTCGGGCAAGATCGACGACAAGACCGCGTTCTAT
CTCGCGGTGTCGGCCGACATGCCGTCGGTCGAACTCGTCGATGCGGTGCCCGCGCGCTTCAAGGTGGGCG
CGCCGGACGACGTCGACAAGCTCGTGCTCTCCGCGATGCCGGGCGTGCGCCTCGCGTACACGCCGCAGGT
GCCGCCCGCGATTCCCGTGCGCCCGGGCGCATGCTATTTCGCACTCGATGCGCGCAGCCCGCTCTATGAG
CGGATGCTGCAGGCCCAGTCGGCGATGATCTATGCGCCGTCCGGAATCAACGATCTCAAATTCGAACTGA
TCGCCGTCACGTCATGA
 Primer design