SecReT6
Protein ID: 76810765
SecReT6 ID91
T6SS typei4b
Gene symbol-
Locus tagBURPS1710b_3643
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007434] [Browse all T6SS(s) in this replicon]
Location [Strand]3969315..3970805 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ3JN45
KEGG IDbpm:BURPS1710b_3643
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.60E-189, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|76810765|ref|YP_335008.1| hypothetical protein BURPS1710b_3643 [Burkholderia pseudomallei 1710b]
MNQQTAAAQSTGVQAGTESSLLDEIVEKSKVAKSESEHARAKDLIGELVSQVLDGTVVVSDNLSATIDAR
VAELDRLISSQLSAVMHAAEFQRLESTWRGLDYLVKESNTGSTIKIKALHAPKRDLVRDFKNATEFDQSA
LFKKVYEEEFGTFGGSPFGVLVGDYEISRQPEDQYFIEQMSHVAAAAHAPFIASAAPELLGLESFADLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGAIAESFNFVEDVDGTDHDKYLWCN
ASWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRIAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDDATQEQKAQFPLREASVQVSEIPGKPGAYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|76808520|ref|NC_007434.1|:c3970805-3969315 Burkholderia pseudomallei 1710b chromosome I, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAATCCACCGGCGTTCAAGCCGGCACGGAATCCTCGCTGCTCGACG
AGATCGTCGAGAAGAGCAAGGTCGCGAAATCCGAATCCGAGCATGCGCGCGCGAAGGATCTGATCGGCGA
GCTCGTCAGTCAGGTGCTTGACGGCACGGTGGTGGTGTCGGACAACCTGTCGGCGACCATCGACGCGCGC
GTCGCGGAGCTCGATCGCCTGATCTCGTCGCAGCTCTCGGCCGTGATGCACGCGGCGGAGTTCCAGCGTC
TCGAGAGCACCTGGCGCGGGCTCGATTACCTGGTGAAGGAAAGCAACACCGGCTCGACGATCAAGATCAA
GGCGCTGCACGCGCCGAAGCGCGATCTCGTGCGCGATTTCAAGAACGCGACCGAGTTCGATCAGAGCGCG
CTCTTCAAGAAGGTGTACGAAGAGGAATTCGGCACGTTCGGCGGCTCGCCGTTCGGCGTGCTGGTGGGCG
ACTACGAGATCTCGCGCCAGCCGGAAGACCAGTACTTCATCGAGCAGATGTCGCACGTCGCGGCCGCCGC
GCACGCGCCGTTCATCGCGTCGGCGGCGCCCGAGCTGCTCGGGCTCGAATCGTTCGCGGATCTCGGCAAG
CCGCGCGATCTCGGCAAGGTGTTCGATACCGTTGAATACGCGAAGTGGAAGTCGTTCCGCGATTCCGAGG
ATTCGCGCTACGTCGGCCTCACGCTGCCGCGCTTTCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCGC
GATCGCGGAGAGCTTCAACTTCGTCGAGGACGTCGACGGCACCGATCACGACAAGTACCTGTGGTGCAAC
GCGTCGTGGGCGTTCGCCGCGCGCCTGACGGCGGCGTTCGACGACTTCGGCTGGTGCGCGGCGATTCGCG
GCGTCGAAGGCGGCGGCCTCGTCGAGGATCTGCCGACCCACACGTTCAAGACCGACGACGGCGAAATCGC
GCTCAAGTGCCCGACCGAGATCGCGATCACCGACCGCCGCGAGAAGGAACTGAGCGATCTCGGTTTCATC
CCGCTCGTGCACTGCAAGAATTCCGATTACGCCGCGTTCTTTGCCGCGCAGTCGGTGCAGAAACCCAAGA
AATACAGCACCGACAGCGCCAACGCGAACGCCGTCCTGTCCGCTCAGCTGCAGTACATCTTCTCGGTATC
GCGCATCGCGCATTACCTGAAGGCGATGATGCGCGACAAGATCGGCAGCTTCGCGTCCGCGCAGAACGTC
GAAACGTTCCTCAATCGCTGGATCTCGCAGTACGTGTTGCTCGACGACGACGCGACGCAGGAACAGAAGG
CGCAGTTCCCGCTGCGCGAGGCCTCCGTACAAGTGTCAGAGATTCCGGGCAAGCCGGGTGCGTATCGTTC
GGTCGCGTTTTTGCGTCCGCACTTCCAGCTCGACGAGTTGTCGATTTCTCTGCGCCTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA
 Primer design