SecReT6
Protein ID: 76810780
SecReT6 ID91
T6SS typei4b
Gene symbol-
Locus tagBURPS1710b_3649
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007434] [Browse all T6SS(s) in this replicon]
Location [Strand]3974611..3975273 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ3JN39
KEGG IDbpm:BURPS1710b_3649
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.10E-55, Aligned region: 2..191
Protein Sequence: 220 a.a.     [Download]
>gi|76810780|ref|YP_335014.1| hypothetical protein BURPS1710b_3649 [Burkholderia pseudomallei 1710b]
MLFLLKNGREPNDASEFGTRIQEFLSEFERGAKKLNIAADDVYAAKFAFCAAIDESVLSSPFKIRADWER
RPLQLVLFGEQLAGEKFYQYLEECRAQGAARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIA
NMKGKRAPFAPHWPLPDQISHRLKREVPLWAIGAVFALVGLLAFVGLNTYLKDSTVRALAPYSQVIKVGP
ESANLTISLP
 
Nucleotide Sequence: 663 bp     [Download]
>gi|76808520|ref|NC_007434.1|:3974611-3975273 Burkholderia pseudomallei 1710b chromosome I, complete sequence
ATGCTGTTCCTGCTGAAGAACGGCCGCGAGCCGAACGACGCGTCGGAATTCGGCACGCGCATTCAGGAAT
TCCTGAGCGAGTTCGAACGCGGCGCGAAGAAGCTCAACATCGCCGCCGACGACGTCTATGCGGCGAAGTT
CGCGTTTTGCGCGGCGATCGACGAATCGGTGCTGTCGTCGCCGTTCAAGATCCGCGCGGACTGGGAGCGC
CGGCCGTTGCAGCTCGTGCTGTTCGGCGAGCAACTCGCGGGCGAGAAGTTCTATCAGTACCTCGAAGAAT
GCCGCGCACAGGGCGCGGCGCGGCTGCAGTCGCTCGAGGTGTTCCATATGTGCCTGCTGCTCGGCTTCCA
GGGCAAGTATCTGCTCGAAGGGCCGGAAAAGCTCGCGTATCTGACCGCACGGCTTGGCGACGAGATCGCG
AACATGAAGGGCAAGCGCGCACCGTTCGCGCCGCATTGGCCGCTGCCGGACCAGATCTCGCACCGGCTCA
AGCGCGAGGTGCCGCTGTGGGCGATCGGAGCGGTGTTCGCGCTCGTCGGGCTGCTGGCGTTCGTCGGGCT
GAATACGTATTTGAAAGACAGCACCGTGCGGGCGCTCGCGCCTTATTCGCAAGTCATCAAGGTGGGGCCG
GAGTCGGCTAATTTGACGATTTCGTTGCCTTGA
 Primer design