SecReT6
Protein ID: 76811212
SecReT6 ID91
T6SS typei4b
Gene symbol-
Locus tagBURPS1710b_3640
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007434] [Browse all T6SS(s) in this replicon]
Location [Strand]3966281..3968119 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ3JN48
KEGG IDbpm:BURPS1710b_3640
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.50E-212, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|76811212|ref|YP_335005.1| hypothetical protein BURPS1710b_3640 [Burkholderia pseudomallei 1710b]
MEELLPYYERELSFLRRYSLEFANRYPKIAARLAQTGEQCEDPHVERMIESFALLGARINKKLDDEYPEF
TEALVEVLYPHYLRPFPSCSIAQFGAPHAFAELTEPRIVERGTELKSRAIRGVQCRFRTAYDVTLAPIRL
ADARYGSVAVAPAAARLPGNATGVISIAFESTSPQLDLAALKLGKLRAHLHGEQSFVAALADCLFAHALA
CYVEPDRGGRWIALGKTPFEHAGFDETDALIDYPARSHPAYRLLTEYFAFPDKFNFVDFDLGALARRAGP
CRQLTLHIALRDVRGDSHVARLLDLLSASHFRLFCTPVVNLFRQHGEPIRVDHRAVSYPVIGDARRAFAY
EVYSIDSVHLVRQRADRETLVEFRPFYSLHHGEAAQAGHYWFARRNDDVARKSPGYETEISVVDVDFEPG
APQTDTLSLDLTCTNRDLPAALATGLDGGDLFIDGGEQPGPIALLRRPTPSARFERGHAAHWRLVSHLAL
NHVSLAEEGLAALKEALVLYDLRRSAVSTRHIDGIVGIEQKSAVQWLPGKPFATFVRGVEIRLAIDDEHF
VGSSLATFVRMIDAFFGLYVHLNSFVQLIVVSRRTGEEIMRCKPRSGESILA
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|76808520|ref|NC_007434.1|:c3968119-3966281 Burkholderia pseudomallei 1710b chromosome I, complete sequence
ATGGAAGAGTTGTTGCCGTATTACGAACGCGAACTGTCGTTTCTGCGGCGCTATTCGCTCGAATTCGCGA
ACCGTTACCCGAAGATCGCCGCGCGTCTCGCCCAGACGGGCGAGCAGTGCGAGGATCCGCACGTCGAGCG
GATGATCGAATCGTTCGCGCTGCTCGGCGCGCGGATCAACAAGAAGCTCGACGACGAATATCCCGAGTTC
ACCGAAGCGCTCGTCGAAGTCCTCTACCCGCACTATCTGCGGCCGTTCCCGTCATGCTCGATCGCGCAGT
TCGGTGCGCCGCATGCGTTCGCGGAGCTCACCGAGCCGCGGATCGTCGAGCGCGGCACCGAGCTGAAGAG
CCGCGCGATTCGCGGCGTGCAGTGCCGGTTCCGCACCGCGTACGACGTGACGCTCGCGCCGATCCGGCTC
GCCGATGCGCGCTACGGATCGGTCGCGGTGGCGCCCGCCGCAGCAAGGCTGCCCGGCAACGCGACGGGCG
TGATCTCGATCGCGTTCGAATCGACGTCGCCGCAGCTCGATCTTGCCGCGCTGAAGCTCGGCAAGCTGCG
CGCGCATTTGCACGGCGAGCAATCGTTCGTCGCCGCGCTGGCCGATTGCCTGTTCGCGCACGCGCTCGCC
TGCTACGTCGAGCCCGATCGCGGCGGCCGCTGGATCGCGCTCGGCAAGACGCCGTTCGAGCACGCGGGCT
TCGACGAGACCGACGCGCTGATCGACTATCCGGCCCGTTCGCATCCGGCCTATCGGCTGCTGACCGAATA
CTTCGCATTCCCGGATAAATTCAACTTCGTCGATTTCGATCTGGGCGCACTCGCGCGGCGCGCGGGGCCC
TGCCGGCAGCTGACGCTGCACATCGCGCTGCGCGACGTGCGCGGCGATTCGCATGTCGCGCGGCTGCTCG
ATCTGCTGAGCGCGAGCCATTTCCGGCTCTTCTGCACGCCGGTCGTGAACCTGTTCCGCCAGCACGGCGA
GCCGATTCGGGTCGACCACCGGGCGGTGTCGTACCCGGTGATCGGCGATGCGCGCCGCGCGTTCGCGTAC
GAGGTATATTCGATCGATTCGGTGCATCTCGTGCGGCAGCGCGCGGACCGCGAAACGCTCGTCGAATTCC
GGCCGTTCTATTCGCTGCATCACGGCGAAGCCGCGCAGGCCGGCCACTACTGGTTCGCGCGGCGCAACGA
CGACGTCGCGCGCAAGAGCCCCGGCTACGAGACCGAGATTTCGGTCGTCGACGTCGACTTCGAGCCGGGC
GCGCCGCAAACCGATACGTTGAGCCTCGATCTCACCTGTACGAACCGCGACCTGCCCGCCGCGCTCGCAA
CGGGGCTCGACGGCGGCGATCTCTTCATCGACGGCGGCGAGCAGCCCGGCCCGATCGCGCTATTGCGCCG
GCCGACGCCGAGCGCGCGCTTCGAGCGCGGCCACGCCGCGCACTGGCGCCTCGTGTCGCATCTCGCGCTC
AATCACGTGTCGCTTGCCGAAGAAGGGCTCGCCGCGCTGAAGGAAGCGCTCGTGCTGTACGATCTGAGGC
GCTCCGCGGTGTCGACGCGCCATATCGACGGGATCGTCGGCATCGAGCAGAAGAGCGCGGTGCAATGGCT
GCCGGGCAAGCCGTTCGCGACGTTCGTGCGCGGCGTCGAGATCCGGCTCGCGATCGACGACGAACATTTC
GTCGGCTCGAGCCTCGCGACGTTCGTGCGGATGATCGACGCGTTCTTCGGGCTGTACGTGCACCTCAACA
GCTTTGTTCAACTGATCGTCGTGTCCAGGCGCACCGGCGAGGAGATCATGCGATGCAAACCGCGCAGCGG
CGAATCGATCCTGGCGTAG
 Primer design