SecReT6
Protein ID: 76818019
SecReT6 ID93
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1204
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1512834..1516463 [-]
ProductSciS protein
NoteTssM
UniProt IDQ3JJ92
KEGG IDbpm:BURPS1710b_A1204
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.20E-96, Aligned region: 213..478
ImcF-related_N [PF14331], Evalue: 1.20E-96, Aligned region: 1062..1079
IcmF-related [PF06761], Evalue: 1.20E-94, Aligned region: 370..390
IcmF-related [PF06761], Evalue: 1.20E-94, Aligned region: 526..836
DUF1215 [PF06744], Evalue: 9.40E-34, Aligned region: 65..87
DUF1215 [PF06744], Evalue: 9.40E-34, Aligned region: 945..1069
Protein Sequence: 1209 a.a.     [Download]
>gi|76818019|ref|YP_336361.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MSHAVARIVRPLPSRDIWTFAGLVVLACFVWLAGPLFAFAEFRPFESGAVRAATIVALFVAWGARIAWRG
WRAGQLNAQLLNQLREAAPRPAATGDPAQAQLDELRSRFDEAATLLKKVRFGEADGARKGLPRWLEQMSR
QYLYQLPWYVFIGAPGSGKTTALVNSGLSFPLAEQFGRAAIRGVGGTRHCDWWFTNDAVLIDTAGRYTTH
ESNRALDEAEWKGFVDLLKKYRARQPLNGAMLTISVADLLGASEAERTQHAMVLRKRLLELRAQLGIRFP
VYLLVTKADLLAGFAEYFGGFGRAECAQVWGFTFPLAESEAPGFELRAAFDREYRLLHQRLNDGLPELLA
SQTDARQREMTYLLPQQIADLQDMLGQFVAEVFSVSSFEPMPMLRGVYLTSGTQEGTAFDRVMSGIKRFL
KIEGVPPAAQTGSSGRSFFLKSLLQDHIFREAALAGSNLRWHQRQRALQIVGYAAIALLCVAVLFAWLRS
YSRNRDYLDEVAARVPAVDAQIGRAKFTGAADIVQLLPVLDELSGLPNAGGVDLRHPPLAYRWGLFQGEK
IEEASDAVYRRALDDVLLPIAASRMEQALRDARPDEVEYAYAALKAYLMLYDSAHYDPAFVQAVVDLEME
RALPADFSSAQRSALRAHLGALFGNRVAVSPFPMNERLVADVRERLRQVPFSQRLYRQLARTLHASTASY
DFSVARAVGPDASLVFRRQSGKSLADGVPGLYTRSGYRSVFAPRLLGAIDSYGREEVWVLNLGASEIPNP
ADAAAWARDIRQLYLNDYIKTWDDYLADIRLQRTSTLAQSIQVARTLSSADSPLTRLMVALARDTPLGDA
PGGARNLASRAQDKVDEARNSLAQIFAGQPGGEAGAAAAPPASPEQIVDSHFAGLRAFAPGGGDQAASFD
AVLKAIDALYTYLTATDDALRSGAAPPPSDAPARLRAQAGRLPTPVREVLDDLSNVANGSIASVEQRNVA
QRAGANVGDFCRQAIAGRYPFARGAARDVAPSDFAQLFAAGGLMDDFFQKNLQTLVDTTAHPWRFNNRNA
EADPSAAAMLGSFEKAAVIRDVYFGGGARTAQIKVEIVPLEMDPSISEMLLDVDGQIVRYAHGPQVPTAV
QWPGTRGSNQVRLQVTEQSGATGGFTTEGPWALHRLFDRAGVSGGRGPEQMVARFAVDGKPIVLQVTASS
VRNPFRLPQMESFTCPPKQ
 
Nucleotide Sequence: 3630 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c1516463-1512834 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGAGCCACGCTGTCGCACGCATCGTTCGCCCGCTGCCGTCGCGGGACATCTGGACGTTCGCCGGCCTCG
TCGTGCTGGCGTGTTTCGTTTGGCTTGCCGGGCCGCTGTTCGCGTTCGCCGAGTTCCGCCCGTTCGAGAG
CGGCGCGGTGCGCGCGGCGACGATCGTCGCGCTGTTCGTCGCGTGGGGCGCGCGGATCGCGTGGCGCGGC
TGGCGCGCGGGGCAACTGAACGCGCAGTTGCTCAACCAGTTGCGCGAAGCGGCGCCGCGGCCCGCCGCGA
CGGGCGATCCCGCGCAGGCGCAGCTCGACGAGCTGCGCAGCCGCTTCGACGAAGCCGCGACGCTGTTGAA
GAAAGTCCGTTTCGGCGAAGCCGACGGCGCGCGCAAGGGCCTGCCGCGGTGGCTCGAGCAGATGTCGCGC
CAGTATCTGTACCAACTGCCGTGGTACGTGTTCATCGGCGCGCCGGGCTCGGGCAAGACGACGGCGCTCG
TCAACTCGGGGCTGAGCTTTCCGCTCGCCGAGCAGTTCGGGCGCGCGGCGATTCGCGGCGTCGGCGGCAC
GCGGCACTGCGACTGGTGGTTCACGAACGACGCGGTGCTGATCGACACCGCGGGCCGCTACACGACGCAC
GAGAGCAACCGCGCGCTCGACGAGGCCGAATGGAAGGGCTTCGTCGATCTGCTGAAGAAGTACCGCGCGC
GCCAGCCGCTGAACGGCGCGATGCTGACGATCAGCGTCGCCGATCTGCTCGGCGCGTCGGAGGCGGAGCG
CACGCAGCACGCGATGGTGCTGCGCAAGCGCCTGCTCGAGCTGCGCGCGCAGCTCGGCATCCGCTTTCCG
GTGTATCTGCTCGTGACGAAGGCGGATTTGCTCGCCGGCTTCGCCGAATACTTCGGCGGCTTCGGCCGCG
CCGAATGCGCGCAGGTGTGGGGCTTCACGTTCCCGCTCGCCGAGAGCGAAGCGCCCGGCTTCGAGCTGCG
CGCGGCGTTCGACCGCGAATACCGGCTGCTGCACCAGCGGCTGAACGACGGGCTGCCGGAGCTGCTCGCA
TCGCAGACCGACGCGCGCCAGCGCGAGATGACCTACCTGCTGCCGCAGCAGATCGCCGATCTGCAGGACA
TGCTCGGCCAGTTCGTCGCCGAGGTGTTCTCGGTGTCGAGCTTCGAGCCGATGCCGATGCTGCGCGGCGT
CTATCTGACGAGCGGCACGCAGGAAGGCACCGCGTTCGACCGCGTGATGAGCGGGATCAAGCGCTTCCTG
AAGATCGAGGGCGTGCCGCCCGCCGCGCAGACGGGCTCGTCGGGCCGCAGTTTCTTCCTGAAATCGCTGC
TGCAGGATCACATCTTTCGCGAGGCGGCGCTTGCCGGCAGCAATCTGCGCTGGCATCAGCGGCAGCGTGC
GCTGCAGATCGTCGGCTACGCGGCGATCGCGCTGCTGTGCGTGGCGGTGCTGTTCGCGTGGCTGCGCAGC
TACTCGCGCAATCGCGACTATCTCGACGAGGTCGCCGCGCGCGTGCCGGCGGTCGACGCGCAGATCGGCC
GCGCGAAATTCACGGGCGCGGCCGACATCGTGCAGCTGCTGCCGGTGCTCGACGAGCTGAGCGGCCTGCC
GAACGCGGGCGGCGTGGACTTGCGGCATCCGCCGCTCGCGTATCGCTGGGGCCTGTTCCAGGGCGAGAAG
ATCGAGGAGGCGAGCGACGCCGTCTACCGGCGCGCGCTCGACGACGTGCTGCTGCCGATCGCCGCGAGCC
GGATGGAGCAGGCGCTGCGCGACGCGCGGCCCGACGAGGTCGAGTATGCGTACGCGGCGCTCAAGGCGTA
CCTGATGCTTTACGACAGCGCGCACTACGATCCCGCGTTCGTGCAGGCCGTCGTCGATCTCGAGATGGAG
CGCGCGCTGCCGGCCGATTTCTCGTCCGCGCAGCGCAGCGCGCTGCGCGCGCATCTCGGCGCGCTGTTCG
GCAATCGCGTCGCGGTGTCGCCGTTTCCGATGAACGAGCGGCTCGTCGCCGACGTGCGCGAGCGGCTGCG
GCAGGTGCCGTTCTCGCAGCGGCTGTATCGGCAGCTCGCGCGCACGCTGCACGCGAGCACCGCGTCGTAC
GATTTCAGCGTCGCGCGCGCGGTGGGGCCGGACGCGTCGCTCGTGTTCCGGCGGCAGAGCGGCAAGAGCC
TCGCCGACGGCGTGCCGGGCCTCTACACGCGCAGCGGCTACCGCAGCGTGTTCGCGCCGCGTCTGCTTGG
CGCGATCGATTCGTACGGGCGCGAGGAGGTGTGGGTGCTGAACCTCGGCGCGTCCGAGATCCCGAATCCG
GCCGACGCGGCCGCCTGGGCGCGCGACATCCGGCAGCTCTACCTGAACGACTACATCAAGACCTGGGACG
ACTATCTGGCCGACATCCGGCTGCAGCGCACGTCGACGCTCGCGCAGAGCATCCAGGTCGCGCGCACGCT
GTCGTCGGCCGATTCGCCGCTCACGCGGCTGATGGTCGCGCTCGCGCGCGACACGCCGCTCGGCGATGCG
CCCGGCGGCGCGCGCAATCTCGCGTCGCGCGCGCAGGACAAGGTCGACGAGGCGCGCAACTCGCTCGCGC
AGATCTTCGCCGGGCAGCCGGGCGGCGAAGCGGGCGCGGCGGCCGCGCCGCCCGCGAGCCCCGAGCAGAT
CGTCGACAGCCACTTCGCGGGGCTGCGCGCGTTCGCGCCGGGCGGCGGGGATCAGGCGGCGTCGTTCGAC
GCGGTGCTCAAGGCGATCGACGCGCTGTACACGTACCTCACCGCGACCGACGACGCATTGCGCAGCGGCG
CGGCGCCGCCGCCGTCGGACGCGCCCGCGCGGCTGCGCGCGCAGGCGGGCCGGTTGCCGACGCCTGTGCG
CGAGGTGCTCGACGATTTGTCGAACGTCGCGAACGGCAGCATCGCGAGCGTCGAGCAGCGCAACGTCGCG
CAGCGCGCGGGCGCGAACGTCGGCGATTTCTGCCGGCAGGCGATCGCCGGGCGCTACCCGTTCGCGCGCG
GCGCGGCGCGCGACGTCGCGCCGTCCGATTTCGCGCAGCTGTTCGCGGCGGGCGGCCTGATGGACGACTT
CTTCCAGAAGAACCTGCAAACGCTCGTCGACACGACCGCGCATCCGTGGCGTTTCAACAACCGCAACGCC
GAAGCCGACCCGTCGGCGGCCGCGATGCTCGGCTCGTTCGAGAAGGCGGCGGTGATCCGCGACGTCTATT
TCGGAGGCGGCGCGCGGACCGCGCAGATCAAGGTCGAGATCGTGCCGCTCGAAATGGACCCGTCGATCTC
GGAGATGCTGCTCGACGTCGACGGCCAGATCGTCCGCTACGCGCACGGCCCGCAGGTGCCGACGGCGGTG
CAGTGGCCCGGCACGCGCGGCAGCAATCAGGTGCGGCTGCAGGTGACCGAGCAGTCGGGGGCGACGGGCG
GCTTCACGACCGAGGGCCCGTGGGCGCTGCACCGGCTGTTCGACCGCGCGGGCGTGTCGGGTGGGCGCGG
ACCCGAGCAGATGGTCGCGAGATTCGCGGTCGACGGCAAGCCGATCGTGCTGCAGGTGACGGCGAGCAGC
GTTCGCAACCCGTTCCGGTTGCCGCAGATGGAGTCCTTTACATGTCCTCCGAAGCAATGA
 Primer design