SecReT6
Protein ID: 76818261
SecReT6 ID92
T6SS typei1
Gene symbol-
Locus tagBURPS1710b_A0549
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]740509..744408 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ3JL47
KEGG IDbpm:BURPS1710b_A0549
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.20E-48, Aligned region: 139..384
ImcF-related_N [PF14331], Evalue: 3.20E-48, Aligned region: 1058..1098
Protein Sequence: 1299 a.a.     [Download]
>gi|76818261|ref|YP_335706.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MFCAALAGWLLCRVARRALRAVRARAQLARLDASERLPAADAPELRVAARWRTALAALGRAQPAPRLRGR
PRDALPWYLVIGPEGAGKTTALARARLVSPLRHARDDAAIAPTEDCDWWCFDDAVVLDLAGRFAAPGATD
DDRRAWHALLEQLGRARARRGVNGVVVAIDAPRLIEASRDALTIEGSAIRERLEQLIRLFDRRFPVYVLV
TQCDRLYGFDEWAAQLAPEQRERAFGYLGDHDADAFVARALDSLDARLGALRVALAARGEPPSPRALMLP
HELACLRPALEAFARAAFGPNVYQETPYLRGLLFASGRQAGGAPSLTLPDWLDAAPARTPGDAGLFLHDV
FARVLPGERDAWLPVERPSRSRLVLRRLALAAWLLASIAAGLLMSASFVGDMRTVELVRRDYPAHPRFTG
EFAHDTATLERIGRVIADVERRDERRLVRPLAGATPVGRLEAELKRRYVAHYRRSIEPTADRLFFGEPDG
ASDVRAADDARLAARIRNLVRYVNLMQARRRGADRETLAQMPAPAVARATDGGGARGVDSVGVSGVSGVS
GVSGVSGVSGVSGVSGGVGGVGGARAAEGAGRAVRASGGRRAGDARAARGMRGAAGNASAGAEIAPAADG
VRDRDEGFARVSALAVDLIAWSAPDDRALAARVAAAQAELERLAYRDPDGAWLLALPDASMPRDVTLADF
WPAAEPRTLPDAQPAALRDVRVPAALTAAHRPAIDAFLDEMAQAVANRPKFAFHRDAFDTWYRARRIDAW
RDFVARFPQGEQGLTTQAQWRAVIDRIADRRDPFAALLARVDREFESERDDTLPPWLRFVRTTSHMLAPA
MLAPARLPAASGGLGAALGSISRSGGRALREALGGAPEQGRLTLERDAALRDALVDYERRVAALAADALA
GPGAAYRLAADFHGFGVDPSVQASAMRAADSALRDVKRLAGDRDVGGDVVWSLVGGPLRALIAYVERQAS
CALQDDWERDVLWPLRRAATRDDVEGLLYGPQGAIWAFVDGPAKPFVRVGAARASALDTLGYRLPFTDAF
LPLIDDAAARRVAQARRDAERRAQQQAALELDERIASLGKQIDALRAQTVRFGIVAQPTDVNPDAQAKPF
ETVLTLQCAPQARTLTNYNLRVSEQIDWQPDRCGDATLRISLGGVTLVRRYAGSLGVARFVQDFRYGVRR
FTPRDFPDAKAQLQRLGVRHIDVRYDFSGHDALLAHVGRIDALERARRDDLARQRRAANRQDDDAGGATA
IARAAASVANAPGAALPRRIGVCWGDPAHDRPDGDGAQP
 
Nucleotide Sequence: 3900 bp     [Download]
>gi|76817237|ref|NC_007435.1|:740509-744408 Burkholderia pseudomallei 1710b chromosome II, complete sequence
GTGTTCTGCGCGGCGCTCGCCGGATGGCTGCTGTGCCGCGTCGCGCGCCGCGCGCTGCGCGCGGTTCGTG
CGCGCGCGCAGCTCGCACGGCTCGACGCATCCGAGCGCCTGCCCGCGGCCGACGCGCCGGAGCTGCGCGT
CGCCGCGCGCTGGCGCACCGCGCTCGCCGCGCTCGGGCGCGCGCAGCCCGCGCCGCGCCTGCGCGGCCGG
CCGCGCGACGCGCTGCCGTGGTATCTCGTGATCGGCCCCGAGGGCGCGGGCAAGACAACCGCGCTCGCAC
GCGCGCGCCTCGTGTCGCCGCTGCGGCACGCGCGCGACGACGCGGCCATCGCGCCGACCGAGGACTGCGA
CTGGTGGTGCTTCGACGACGCGGTCGTGCTCGATCTCGCGGGCCGCTTCGCCGCGCCCGGCGCGACCGAC
GACGATCGCCGCGCATGGCACGCGCTCCTCGAGCAGCTCGGCCGCGCGCGTGCGCGCCGGGGCGTGAACG
GCGTCGTGGTCGCGATCGACGCGCCGCGCCTCATCGAAGCGAGCCGCGATGCGCTGACGATCGAAGGCAG
CGCCATTCGCGAACGGCTCGAGCAACTGATCCGCCTGTTCGACCGGCGCTTTCCGGTGTACGTGCTCGTC
ACGCAATGCGACCGGCTCTACGGCTTCGACGAATGGGCCGCGCAGCTCGCGCCGGAACAACGCGAGCGCG
CGTTCGGCTATCTCGGCGATCACGACGCGGATGCGTTCGTCGCGCGCGCGCTCGACAGCCTCGACGCACG
GCTCGGCGCACTGCGCGTCGCGCTGGCGGCGCGCGGCGAGCCGCCGTCGCCGCGCGCGCTGATGCTGCCG
CACGAACTCGCGTGCCTGCGGCCCGCGCTCGAGGCGTTCGCACGCGCGGCGTTCGGCCCGAACGTCTATC
AGGAAACACCGTATCTGCGCGGGCTGCTGTTCGCGAGCGGCCGGCAGGCGGGCGGCGCGCCGTCGCTGAC
GCTGCCCGACTGGCTCGACGCCGCGCCGGCGCGCACGCCCGGCGATGCGGGCCTGTTCCTGCACGACGTG
TTCGCGCGCGTGCTGCCGGGCGAGCGCGACGCGTGGCTGCCCGTCGAGCGGCCGAGCCGCTCGCGGCTCG
TGCTGCGGCGCCTCGCGCTCGCCGCGTGGCTCCTCGCGAGCATCGCGGCCGGGCTGCTGATGAGCGCATC
GTTCGTCGGCGACATGCGAACCGTCGAGCTGGTCCGCCGCGACTATCCCGCGCATCCGCGCTTCACCGGC
GAATTCGCGCACGACACGGCGACGCTCGAGCGGATCGGCCGCGTGATCGCCGACGTCGAGCGGCGCGACG
AGCGGCGGCTCGTGCGCCCGCTCGCCGGCGCGACGCCCGTCGGCCGGCTCGAAGCGGAACTCAAGCGCCG
CTACGTCGCGCACTATCGGCGCTCGATCGAACCCACCGCCGATCGGCTGTTCTTCGGCGAGCCGGACGGC
GCGAGCGACGTGCGCGCGGCCGACGATGCGCGGCTCGCCGCGCGCATCCGCAATCTGGTCCGCTACGTGA
ACCTGATGCAGGCGCGCCGGCGCGGCGCGGATCGCGAGACGCTCGCGCAAATGCCCGCACCGGCGGTCGC
GCGCGCGACGGATGGCGGTGGCGCTCGCGGAGTGGACAGTGTGGGTGTTTCTGGTGTTTCTGGTGTTTCT
GGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGCGGTGTAGGCGGTGTAGGCGGTG
CGCGCGCCGCGGAAGGCGCGGGTCGCGCCGTCCGCGCGAGCGGCGGACGGCGCGCAGGCGACGCGCGCGC
CGCGCGCGGCATGCGCGGCGCCGCCGGCAACGCCAGCGCCGGCGCTGAAATCGCACCCGCCGCAGACGGC
GTTCGCGATCGCGACGAAGGGTTTGCGCGCGTCAGCGCGCTCGCCGTCGACCTGATCGCGTGGAGCGCGC
CCGACGATCGCGCGCTCGCCGCGCGCGTCGCGGCCGCGCAGGCAGAGCTCGAACGGCTCGCGTACCGCGA
TCCGGACGGCGCGTGGCTGCTCGCGCTACCGGATGCCTCGATGCCGCGCGACGTGACGCTCGCCGATTTC
TGGCCCGCCGCCGAGCCGCGCACGCTGCCCGACGCACAGCCCGCCGCGCTGCGCGACGTGCGCGTGCCCG
CCGCGCTGACGGCCGCGCATCGCCCGGCCATCGATGCGTTCCTCGACGAGATGGCGCAGGCGGTCGCGAA
CCGGCCGAAGTTCGCGTTCCATCGCGACGCGTTCGACACGTGGTACCGCGCACGGCGCATCGACGCATGG
CGCGACTTCGTCGCACGCTTCCCGCAGGGCGAGCAAGGGCTGACGACGCAAGCGCAATGGCGCGCGGTGA
TCGACCGGATCGCCGATCGCCGCGATCCGTTCGCGGCATTGCTCGCGCGCGTCGATCGCGAATTCGAATC
CGAGCGCGACGACACGCTGCCGCCGTGGCTACGGTTCGTGCGCACGACATCGCACATGCTCGCCCCCGCG
ATGCTCGCGCCCGCGCGCCTGCCCGCGGCGAGCGGCGGCCTGGGCGCCGCGCTCGGCTCGATCTCGCGCA
GCGGCGGACGCGCGCTGCGCGAAGCGCTCGGCGGCGCGCCCGAGCAAGGCAGGCTCACGCTCGAGCGCGA
TGCCGCGCTGCGCGACGCGCTTGTCGACTACGAGCGGCGCGTCGCCGCGCTCGCCGCCGATGCGCTTGCG
GGCCCCGGCGCCGCGTACCGGCTCGCGGCCGATTTCCACGGCTTCGGCGTCGATCCGTCCGTCCAGGCTT
CCGCGATGCGCGCGGCCGACAGCGCGCTGCGCGACGTCAAGCGGCTCGCGGGCGATCGCGACGTCGGCGG
CGACGTCGTCTGGAGCCTCGTCGGCGGCCCGCTGCGCGCGCTGATCGCGTATGTCGAGCGGCAGGCGTCG
TGCGCACTGCAGGACGACTGGGAGCGCGACGTGCTGTGGCCGCTCAGGCGCGCGGCGACGCGCGACGACG
TGGAGGGCTTGCTGTACGGCCCGCAAGGCGCGATCTGGGCGTTCGTCGACGGCCCGGCGAAGCCGTTCGT
GCGTGTCGGCGCGGCGCGTGCATCGGCGCTCGACACGCTCGGCTACCGGCTGCCGTTCACCGACGCGTTC
CTGCCGCTCATCGACGACGCGGCCGCCCGGCGCGTCGCGCAAGCGCGGCGCGACGCCGAGCGGCGCGCGC
AACAGCAGGCGGCGCTCGAGCTGGACGAGCGGATCGCATCGCTCGGCAAGCAGATCGACGCGCTGCGCGC
GCAAACGGTGCGCTTCGGGATCGTCGCGCAGCCGACCGACGTGAACCCGGATGCGCAGGCCAAGCCGTTC
GAAACCGTGCTGACGCTGCAATGCGCGCCGCAGGCGCGCACGCTGACGAACTACAACCTGCGCGTGTCCG
AGCAGATCGACTGGCAACCCGATCGATGCGGCGACGCGACGCTGCGCATCTCGCTCGGCGGCGTCACGCT
CGTGCGCCGTTACGCGGGATCGCTCGGCGTCGCGCGCTTCGTCCAGGACTTCCGCTACGGCGTGCGCCGC
TTCACGCCCCGCGATTTCCCGGACGCGAAAGCGCAGCTTCAACGTCTCGGCGTGCGCCACATCGACGTGC
GTTACGACTTCTCCGGGCATGACGCGCTGCTCGCGCACGTCGGTCGGATCGACGCGCTCGAACGCGCGCG
CCGCGACGACCTCGCGCGGCAGCGGCGCGCCGCGAACCGGCAGGACGACGACGCGGGCGGCGCGACGGCG
ATCGCGCGGGCGGCGGCGTCCGTCGCGAATGCGCCGGGCGCCGCGCTGCCCCGCCGCATCGGCGTGTGTT
GGGGGGACCCGGCGCACGACAGGCCCGATGGCGACGGCGCGCAACCGTGA
 Primer design