SecReT6
Protein ID: 76818309
SecReT6 ID96
T6SS typei3
Gene symbolicmF3
Locus tagBURPS1710b_A2090
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2545077..2548391 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ3JGR2
KEGG IDbpm:BURPS1710b_A2090
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.50E-69, Aligned region: 430..736
IcmF-related [PF06761], Evalue: 2.50E-69, Aligned region: 807..817
ImcF-related_N [PF14331], Evalue: 2.60E-29, Aligned region: 125..314
DUF1215 [PF06744], Evalue: 1.30E-27, Aligned region: 17..36
DUF1215 [PF06744], Evalue: 1.30E-27, Aligned region: 237..255
DUF1215 [PF06744], Evalue: 1.30E-27, Aligned region: 841..966
Protein Sequence: 1104 a.a.     [Download]
>gi|76818309|ref|YP_337241.1| icmF3 gene product [Burkholderia pseudomallei 1710b]
MSPRQVKVAPKAKQLDFVDKHLRTLDQQLKERWRKEPRGRWKRWVGALTREHRTMLPWYLVLGSEGSGKS
SLVAKAVSVSGSLQDRVLGSDATYGRGDDLNFRITREAVWFDVGGRWSLRAGADEAEFDAWRKLLRGMRR
LRRGAPISGVVLCVDGLEMIDAPLDARKRLADSVRARLEEMREAFGQQVQVYVALNGLDRLDGAVSTLSL
LEASKWVKGVGFSLPDDGAHADAARADASWQHALQGLQQRVQQQVLYSAPAATEVSMNHAQLRFVETLSR
LQKALVAWLHVALAPGEPHTAARLRGVWLGSMAELAEPHPAGAGGVGSAELPVPSRPLSELWTPLIRQVA
LERDAVRPSGPKSWRGRLGEALRWGAVPLVALSLLLWFGWGYVTERDYLDGVWAQFTEAKRLAQAEASYG
NDGGSTLIEIANQMRYAQLQAEDAAQGMATPYFEHGLVAETARETYYRHLQKMLMPELYNEVRRTLVSQV
DGSPGDIYQTLKVYLMLCRPARRSADDVVRWLDGRWDALSGGQYSDDDRRSLLAHVRTLMSLKEVPATPE
DANLVRSARAKAAQIPLVTRVLQHIHAQGLPQQVNDISLSRAAGFEASMSLRMRSNVPSTDTAVSGWFTR
AGYTDVFLPRLQKSARAMLEEESWVLRDETLSGNSFQIDGLVQKLADSARNQFLQDYISAWQNFLNDVTV
RGVTGLDDASQLAAAMMEAQSPLANLLRFAARETTLTGASDEGNIDSWIDRQKYRFEKGRRQVVGELSGQ
HYRTVLLPEHVVEEHFQAIRQLAAQLNRNNTIANNPLSRLFEPLYRQLGLVNGALQAGQVLPAQYDAFSR
LKETAARQPEPVRGIMLDLVSSGSTMTTRESGALLNRGAAGATKMVCDQGFTGRYPMRRGAQADAGVEDF
ERLFSAQGLMATYFRDHLAAYVDTSAKPWQALRSNGGPNGMVSQSVLNSYETAERIRGAMLDDSGHLRVS
TVLRFIDMDSQLSEAQLSVAGQTVRFAHGVTSPHRVDWTNQNTQLAIKLQLKSVDGRMTTLQFDGPWALF
RFFDAGQAVGGTGTADRRERLYQTSLGTVRIEWQALTLPSPIWSGILQSFRCPS
 
Nucleotide Sequence: 3315 bp     [Download]
>gi|76817237|ref|NC_007435.1|:2545077-2548391 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGAGCCCGCGGCAGGTGAAGGTCGCGCCGAAGGCCAAGCAGCTCGATTTCGTCGACAAGCATCTGCGCA
CCCTCGACCAGCAGTTGAAGGAGCGCTGGCGCAAGGAGCCGCGCGGCCGCTGGAAGCGCTGGGTCGGCGC
GCTCACGCGCGAGCATCGCACGATGCTGCCGTGGTATCTGGTGCTCGGCTCCGAGGGTAGCGGCAAGTCG
AGCCTCGTCGCGAAGGCGGTGAGCGTGTCCGGCTCGCTGCAGGACCGGGTGCTCGGCTCGGACGCGACCT
ACGGGCGCGGCGACGACTTGAACTTCCGCATCACGCGCGAGGCGGTGTGGTTCGACGTCGGCGGCCGCTG
GAGCCTGCGCGCGGGCGCGGACGAGGCCGAGTTCGACGCGTGGCGCAAGCTGCTGCGCGGGATGAGGCGG
CTGCGCAGGGGCGCGCCGATCAGCGGCGTCGTGCTGTGCGTCGACGGCCTCGAGATGATCGATGCGCCGC
TCGACGCGCGCAAGCGGCTGGCCGATTCGGTGCGCGCGCGGCTCGAGGAGATGCGCGAGGCGTTCGGCCA
GCAGGTGCAGGTGTACGTCGCGCTGAACGGGCTCGACCGGCTCGACGGCGCGGTCTCGACGCTGTCGCTG
CTCGAGGCGTCGAAGTGGGTCAAGGGCGTGGGCTTCAGCCTGCCCGACGACGGCGCGCACGCCGACGCCG
CGCGCGCGGACGCGAGCTGGCAGCACGCGCTGCAAGGGCTGCAGCAGCGGGTCCAGCAGCAGGTGCTGTA
TTCGGCGCCGGCGGCGACCGAGGTGTCGATGAACCACGCGCAGTTGCGCTTCGTCGAGACGCTCAGCCGC
CTGCAGAAGGCGCTCGTCGCGTGGCTGCACGTCGCGCTCGCGCCGGGCGAGCCGCACACGGCCGCGCGGC
TGCGCGGGGTGTGGCTGGGCTCGATGGCCGAGCTCGCGGAGCCGCATCCGGCGGGCGCGGGCGGCGTCGG
CTCGGCGGAGCTGCCCGTGCCGTCGCGCCCGCTCAGCGAGCTGTGGACGCCGCTCATCCGGCAGGTGGCG
CTCGAGCGCGACGCGGTGCGCCCGAGCGGGCCGAAGTCGTGGCGCGGGCGCCTGGGCGAGGCGCTGCGCT
GGGGCGCGGTGCCCCTCGTCGCGTTGAGCCTGCTGCTGTGGTTCGGCTGGGGCTACGTCACCGAGCGCGA
CTATCTGGACGGCGTCTGGGCGCAGTTCACCGAGGCCAAGCGGCTCGCGCAGGCCGAGGCGTCCTACGGC
AACGACGGCGGCTCGACGCTCATCGAGATCGCGAATCAGATGCGCTATGCGCAACTGCAGGCCGAGGACG
CCGCGCAGGGCATGGCGACGCCGTACTTCGAGCACGGGCTCGTCGCGGAAACCGCGCGCGAGACCTACTA
CCGGCACTTGCAGAAGATGCTGATGCCGGAGCTGTACAACGAGGTGCGGCGCACGCTCGTGTCGCAGGTC
GACGGCAGCCCGGGCGACATCTACCAGACGCTGAAGGTCTACCTGATGCTCTGCCGCCCCGCGCGGCGCT
CGGCGGACGACGTCGTGCGCTGGCTCGACGGCCGCTGGGACGCGCTCTCGGGCGGGCAGTACTCGGACGA
CGACCGCCGCTCGCTGCTCGCGCACGTGCGCACGCTGATGTCGCTGAAGGAGGTGCCGGCCACGCCGGAG
GACGCGAATCTCGTGCGCTCGGCGCGCGCGAAAGCCGCGCAGATCCCGCTCGTCACGCGCGTGCTGCAGC
ACATCCACGCGCAGGGGCTGCCGCAGCAGGTCAACGACATCTCGCTGTCGCGCGCGGCGGGCTTCGAGGC
GTCGATGAGCCTGCGCATGCGCAGCAACGTGCCGTCGACCGACACCGCGGTGTCGGGCTGGTTCACGCGC
GCGGGCTACACGGACGTGTTCCTGCCGCGCCTGCAGAAGAGCGCGCGCGCGATGCTCGAGGAGGAGAGCT
GGGTGCTGCGCGACGAGACGCTGTCGGGCAACAGCTTCCAGATCGACGGACTCGTGCAGAAGCTCGCCGA
TTCGGCGCGCAACCAGTTCCTGCAGGACTACATCTCCGCGTGGCAGAACTTCCTGAACGACGTGACGGTG
CGCGGCGTGACGGGCCTGGACGATGCGTCGCAGCTCGCCGCGGCGATGATGGAGGCGCAATCGCCGCTCG
CGAACCTGCTGCGCTTCGCCGCGCGCGAGACGACGCTCACGGGCGCGAGCGACGAAGGCAACATCGACAG
CTGGATCGATCGCCAGAAGTACCGCTTCGAGAAGGGGCGGCGGCAGGTCGTCGGCGAGCTGAGCGGGCAG
CATTACCGCACGGTGCTGCTGCCGGAGCACGTGGTCGAGGAGCACTTCCAGGCGATCCGCCAGCTCGCCG
CGCAACTGAACCGCAACAACACGATCGCGAACAACCCGCTGTCGCGGCTGTTCGAGCCGCTGTACCGGCA
GCTCGGGCTCGTCAACGGCGCGCTGCAGGCGGGCCAGGTGCTGCCCGCGCAGTACGACGCGTTCTCGCGG
CTGAAGGAGACGGCCGCGCGCCAGCCGGAGCCGGTGCGCGGGATCATGCTCGACCTCGTGAGCAGCGGCA
GCACGATGACGACGCGCGAATCGGGCGCGCTGCTCAACCGGGGCGCGGCGGGCGCGACGAAGATGGTCTG
CGATCAGGGCTTCACGGGCCGCTATCCGATGCGCCGCGGCGCGCAGGCGGATGCGGGCGTGGAGGACTTC
GAGCGGCTGTTCAGCGCGCAGGGGCTGATGGCGACGTACTTCCGCGATCACCTCGCCGCATATGTGGACA
CATCGGCCAAGCCGTGGCAGGCGCTGCGCTCGAACGGCGGGCCGAACGGGATGGTGAGCCAGTCGGTGCT
GAACTCGTACGAGACGGCCGAGCGCATCCGCGGCGCGATGCTCGACGATTCGGGACACCTGCGCGTGTCG
ACCGTGCTGCGTTTCATCGACATGGATTCGCAGTTGTCCGAAGCGCAACTGAGCGTGGCCGGGCAGACGG
TGCGCTTCGCGCACGGCGTGACCTCGCCGCACCGGGTGGACTGGACCAACCAGAACACGCAGCTCGCGAT
CAAGCTGCAGCTCAAATCGGTGGACGGCCGGATGACGACGCTGCAGTTCGACGGGCCGTGGGCGCTGTTC
CGCTTCTTCGACGCGGGGCAGGCGGTGGGCGGCACGGGCACTGCGGACCGGCGCGAGCGGCTGTATCAGA
CGAGCCTCGGCACGGTGCGCATCGAATGGCAGGCGCTCACGCTGCCGTCGCCGATATGGTCGGGCATCCT
GCAGTCGTTCAGGTGTCCGTCGTGA
 Primer design