SecReT6
Protein ID: 76818330
SecReT6 ID94
T6SS typei3
Gene symbolsciS
Locus tagBURPS1710b_A1610
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1962287..1966195 [+]
ProductSciS protein
NoteTssM
UniProt IDQ3JI36
KEGG IDbpm:BURPS1710b_A1610
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-97, Aligned region: 42..57
ImcF-related_N [PF14331], Evalue: 1.30E-97, Aligned region: 264..541
IcmF-related [PF06761], Evalue: 2.40E-91, Aligned region: 393..495
IcmF-related [PF06761], Evalue: 2.40E-91, Aligned region: 590..913
DUF1215 [PF06744], Evalue: 2.80E-33, Aligned region: 638..664
DUF1215 [PF06744], Evalue: 2.80E-33, Aligned region: 1036..1159
Protein Sequence: 1302 a.a.     [Download]
>gi|76818330|ref|YP_336767.1| sciS gene product [Burkholderia pseudomallei 1710b]
MSYLKRFLRFVFSWQMLACIAVLLVCAAVWFVGPLLAFDELRPLAGVVVRVAVIVLLVALLAFWLLRWPL
SPIGVAALCLLIWHAGPLFAFGDHRPFGPAWVRVLIVAAMLFCYAVYGLYRLWQAVRTNDALLKRILEPS
AGKPDAAAQANIRAVSVAVSKAIGQLKRLRGGAFGWRRLLESGRYLYELPWYMVVGAPGAGKSAAIARSG
LKFPLADQMEASSERARGGTANCEWWFANEAVLIDTAGRYVRHEVPGDEEATVANGAEWKGFLGLLRKHR
PRAPVNGVVLSVSVEELVGRTPAERTAHAATLRARLGELHQELGIHFPVYVIVTKLDLLPGFPEYFQSLT
AEGRTQIWGFTLPYDAENRRSAVGALREHCADELKRLEMRIDAGLNNRLLEEYENDRRKRLYALPQEFRS
LSAALSDMLALVFLDSRYDDAQLQNTLRGVYFTSAEQTDQVLAADRETILQRLKRQLGRMLGGDAGAQTR
DSGAVSGSRGYFLRDVFQHVIVPEAHLVRPNVRWEVRFRLMRWAGHLLAVALLVWLASALTVSFDNNRGY
LDAISEKTAALAARVNAYNKAPKPAQIGGVLDGARDLPQHGNLDLDAPGASFRYGLYVAPGIVDASDATY
RSLLRRSLLPQIVRRVENALSAQIDAKHADEVYRTLTVYLMLDDAARHDAKAVKDWVMRDWERSDSAAEM
GGRNLMARHLDALFVDARPFEPSGHRNAALVQRARLFLNANPAPRRLYERAMAAIEKEAPENFTLARAVG
LQGAGIFRLADGSRFQRGMPGLYTYDGYHQVFSVRLPEFLARAQSDDAWVMGNAGPAARWGDAIRNTQAV
AGRSSLADDIRRQYLTDYGNYWQQYLADIRPASSGEDGAGGTLAFDLATLRALAAPDSPLVRLARAVVRE
TSLSVVDAREDASLTDAALSALGRRSGAAKEVADGAQKLAARRPEQRLEKEVVDNRFAALREVVTGQADT
GSGPAMTDVPVAAGGRALQLDAILTLINEQYTRLVVADNALSSQSMPPALDIGTTLQMEAEKLPAPLRTV
LGGIATQAADKVGREVGSLLAMQVDSSVGNACRAAVDGKYPFARSAQEVDIEDFNRLFAAGGLFDAFFQK
ALAPHVDTHSKPWRYKALNPGMPPIRGPSLEPFERAAAIRDVFFREPGAKRMAWKMDAKVASIDPEITEL
IVDVDGQSQRYVHGPVLPFSVNWPGPRGGAIAEITAKPRIRPDTSTIATTGPWALFRLIERGRLTGTTSA
SRLMLDFDFDGRHAALELRTNGQMNPLTSGLLTHFRCPGSVG
 
Nucleotide Sequence: 3909 bp     [Download]
>gi|76817237|ref|NC_007435.1|:1962287-1966195 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGTCTTACCTGAAACGCTTCTTGAGATTCGTCTTTTCGTGGCAGATGCTCGCATGCATCGCGGTGCTGC
TTGTTTGCGCCGCCGTATGGTTCGTCGGCCCCCTGCTCGCGTTCGACGAGTTGCGGCCGCTCGCGGGCGT
CGTCGTGCGGGTCGCCGTCATCGTCCTTCTCGTGGCGCTCCTTGCGTTCTGGCTGTTGCGCTGGCCGCTC
AGCCCGATCGGCGTCGCCGCACTGTGTCTGCTGATCTGGCACGCGGGGCCGCTCTTCGCGTTCGGCGATC
ACCGCCCGTTCGGGCCCGCGTGGGTCCGCGTGCTGATCGTCGCCGCGATGCTCTTCTGCTACGCCGTGTA
TGGTCTCTATCGCCTGTGGCAGGCGGTTCGGACGAACGACGCATTGCTCAAGCGCATTCTCGAGCCGTCG
GCGGGCAAGCCGGACGCGGCGGCCCAGGCGAACATCCGTGCGGTGAGCGTGGCGGTGTCGAAGGCGATCG
GTCAACTGAAGCGCTTGCGCGGCGGTGCGTTCGGCTGGCGGCGCTTGCTCGAAAGCGGGCGCTACCTGTA
TGAACTGCCGTGGTACATGGTGGTCGGCGCGCCTGGTGCGGGCAAGAGCGCGGCGATCGCGCGTTCCGGC
CTGAAGTTTCCGCTCGCGGATCAGATGGAGGCATCGTCCGAGCGCGCGCGGGGCGGCACGGCCAATTGCG
AATGGTGGTTCGCCAACGAGGCCGTGTTGATCGACACGGCGGGCCGTTACGTGCGGCACGAGGTGCCCGG
CGACGAAGAGGCGACAGTTGCCAACGGGGCGGAGTGGAAGGGCTTTCTCGGTCTGCTTCGCAAACATCGG
CCGCGCGCGCCGGTCAATGGCGTGGTCCTGTCGGTCAGCGTCGAGGAGCTCGTCGGGCGCACGCCGGCCG
AGCGCACCGCGCACGCAGCCACGCTGCGCGCCCGCCTGGGCGAGTTGCATCAGGAACTGGGCATTCATTT
CCCGGTATACGTGATCGTCACGAAACTCGATTTGCTGCCCGGCTTTCCGGAGTATTTCCAGTCGTTGACG
GCCGAAGGGCGGACGCAGATCTGGGGATTCACGCTGCCCTACGACGCGGAGAACAGGCGGAGCGCGGTCG
GCGCGCTGCGCGAGCATTGCGCCGACGAGCTGAAGCGGCTGGAGATGCGTATCGACGCGGGGCTGAACAA
CCGTCTGCTCGAAGAGTACGAAAACGATCGCCGCAAGCGGCTGTATGCGTTGCCGCAGGAGTTCCGGAGC
CTGTCGGCCGCGCTGTCGGACATGCTCGCCCTCGTGTTTCTCGATTCACGCTACGACGACGCCCAGTTGC
AGAACACGCTGCGCGGCGTCTACTTCACGAGCGCCGAGCAGACGGATCAGGTATTGGCCGCGGATCGCGA
AACCATCCTGCAGCGCTTGAAGCGCCAACTCGGCAGAATGCTCGGCGGCGATGCCGGCGCGCAGACGCGT
GACAGCGGCGCGGTGTCGGGCAGCCGCGGCTACTTCCTGCGCGATGTGTTCCAGCATGTGATCGTGCCGG
AGGCGCATCTGGTTCGGCCGAACGTCAGGTGGGAGGTGCGTTTTCGCCTGATGCGCTGGGCCGGGCATCT
GCTCGCCGTCGCATTGCTGGTCTGGCTGGCGAGCGCGCTGACGGTGAGCTTCGACAACAATCGCGGTTAC
CTGGACGCGATCTCGGAAAAGACAGCCGCGCTCGCCGCACGAGTCAACGCGTACAACAAGGCGCCGAAGC
CGGCGCAGATCGGGGGCGTACTGGATGGCGCGCGCGATCTTCCTCAGCATGGCAATCTCGATCTCGACGC
GCCCGGCGCGAGCTTCCGCTACGGCCTGTATGTCGCACCCGGCATCGTCGACGCGTCCGACGCGACTTAT
CGGAGCCTGCTGCGCCGGAGCCTTCTGCCGCAGATCGTGCGGCGCGTCGAGAATGCACTGAGCGCGCAAA
TCGATGCGAAGCATGCGGACGAGGTCTATCGCACGCTGACGGTCTACTTGATGCTCGACGACGCCGCGCG
CCATGACGCGAAGGCGGTGAAAGACTGGGTCATGCGCGACTGGGAGCGCTCGGATAGCGCGGCCGAGATG
GGGGGGCGCAATTTGATGGCGCGGCACCTGGACGCGCTGTTCGTCGATGCTCGGCCTTTCGAGCCGAGCG
GGCACCGGAACGCCGCACTCGTTCAGCGCGCCCGGCTTTTCCTCAACGCGAACCCGGCCCCGAGGCGGCT
GTACGAGCGTGCGATGGCCGCGATCGAGAAGGAGGCGCCGGAGAACTTCACGCTCGCGCGTGCGGTCGGG
CTTCAGGGCGCGGGCATCTTTCGGCTCGCCGACGGCTCGCGGTTTCAACGCGGGATGCCCGGCTTGTATA
CGTACGATGGCTACCACCAGGTATTCAGCGTCCGGTTGCCCGAATTTCTCGCCCGTGCGCAAAGCGACGA
CGCATGGGTGATGGGGAACGCCGGCCCCGCCGCGCGATGGGGCGACGCGATTCGGAACACGCAGGCCGTT
GCGGGTCGGTCTTCGCTTGCCGACGACATTCGTCGCCAGTACCTGACGGATTACGGCAACTATTGGCAAC
AGTATCTGGCGGACATTCGGCCCGCGTCGTCCGGAGAGGACGGCGCGGGCGGCACGCTCGCATTCGATCT
CGCGACGCTGCGCGCGCTCGCCGCCCCCGATTCACCGCTCGTGAGACTGGCGCGCGCCGTCGTTCGCGAA
ACATCGCTGTCGGTCGTCGACGCACGGGAAGACGCGTCGTTGACCGACGCCGCGCTTTCGGCGCTCGGGC
GACGATCCGGCGCGGCGAAGGAGGTTGCCGACGGCGCGCAGAAACTGGCGGCGCGGCGGCCGGAGCAGCG
CCTCGAGAAGGAAGTGGTGGACAACCGCTTCGCGGCGCTGCGCGAGGTGGTGACGGGGCAGGCCGACACG
GGAAGCGGGCCGGCGATGACGGACGTGCCGGTCGCGGCGGGGGGCCGGGCGCTGCAGCTCGATGCGATCC
TCACGCTGATCAACGAACAGTACACGCGCCTCGTCGTTGCCGACAACGCGCTCTCGTCGCAGAGCATGCC
GCCCGCGCTGGACATCGGCACCACCTTGCAAATGGAGGCGGAGAAACTGCCCGCGCCGCTGCGCACGGTG
CTGGGCGGCATCGCGACGCAAGCCGCCGACAAAGTCGGGCGCGAAGTGGGTTCGCTGCTCGCGATGCAGG
TGGACTCGAGTGTCGGCAACGCGTGTCGCGCCGCCGTCGACGGCAAGTATCCGTTCGCGCGCAGCGCGCA
GGAAGTCGACATCGAGGATTTCAACCGCCTCTTCGCCGCGGGCGGCCTGTTCGACGCGTTTTTTCAGAAG
GCGCTCGCGCCGCATGTCGACACCCATTCGAAGCCGTGGCGTTACAAGGCGTTGAATCCCGGCATGCCGC
CGATCCGGGGGCCGAGCCTCGAGCCGTTCGAGCGCGCCGCCGCGATTCGCGACGTGTTCTTTCGTGAACC
GGGCGCAAAGCGGATGGCGTGGAAGATGGATGCGAAGGTGGCGTCGATCGACCCTGAGATCACCGAGCTC
ATCGTCGACGTCGACGGCCAGTCGCAGCGCTATGTCCACGGCCCCGTGCTGCCGTTCTCCGTGAACTGGC
CCGGGCCGCGCGGCGGCGCGATCGCCGAGATCACCGCGAAGCCGCGGATTCGTCCCGATACGTCGACGAT
CGCGACGACGGGGCCCTGGGCGCTGTTTCGGCTGATCGAGCGCGGGCGGTTGACGGGCACCACGTCGGCG
AGCCGGTTGATGCTGGATTTCGATTTCGACGGTCGGCACGCGGCCCTGGAGCTCAGGACGAACGGCCAGA
TGAATCCGTTGACGAGCGGCTTGCTGACGCATTTTCGCTGTCCGGGGAGCGTCGGTTGA
 Primer design