SecReT6
Protein ID: 77358930
SecReT6 ID70
T6SS typei1
Gene symbol-
Locus tagBMAA0729.1
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]738692..743269 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ4V2Q5
KEGG IDbma:BMAA0729.1
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.20E-48, Aligned region: 353..598
ImcF-related_N [PF14331], Evalue: 3.20E-48, Aligned region: 1284..1324
Protein Sequence: 1525 a.a.     [Download]
>gi|77358930|ref|YP_338386.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MRGRTRGRRRRRAVRGVRVDRRGAAEQRLGRCRSLDAAAAAKALLRYVARGRRVLRTPRHARRRARERAR
GLPAVPAARLSRPLRLRRRRRPARRDPPARARCTVGARAAVRRGRAAVSRRLCARRPARRRRESAHAPPD
RARGAERRAAARHPAVALSDLSRRHRADGRRGVPQAAMKTLGMMIARIAALLALAALSWASALYFDWPLW
CAPAVFCAALAGWLLCRVARRALRAVRARAQLARLDASERLPAADAPELRVAARWRTALAALGRAQPAPR
LRGRPRDALPWYLVIGPEGAGKTTALARARLASPLRHARDDAAIAPTEDCDWWCFDDAVVLDLAGRFAAP
GATDDDRRAWHALLEQLGRARARRGVNGVVVAIDAPRLIEASRDALTIEGSAIRERLEQLIRLFDRRFPV
YVLVTQCDRLYGFDEWAAQLAPEQRERAFGYLGDHDADAFVARALDSLDARLGALRVALAARGEPPSPRA
LMLPHELACLRPALEAFARAAFGPNVYQETPYLRGLLFASGRQAGGAPSLTLPDWLDAAPARTPGDAGLF
LHDVFARVLPGERDAWLPVERPSRSRLVLRRLALAAWLLASVAAGLLMSASFVGDMRTVELVRRDYPAHP
RFTGEFAHDTATLARIGRVIADVERRDERRLVRPLAGATPVGRLEAELKRRYVAHYRRSIEPTADRLFFG
KPDGASDMRAANDARLAARIRNLVRYVNLMQARRRGADRETLAQMPAPAVARATDGGGARGVDSVGVSGV
SGVSGVSGVSGVSGVSGVSGVSGVSGVSGGVGGVGGVGGARAAEGAGRAVRASGGRRAGDARAARGMRGA
AGNAGAGAEIAPAADGVRDRDEGFARVSALAVDLIAWSAPDDRALAARVAAAQAELERLAYRDPDGAWLL
ALPDASMPRDVTLADFWPAAEPRTLPDAQPAALRDVRVPAALTAAHRPAIDAFLDEMAQAVANRPKFAFH
RDAFDTWYRARRIDAWRDFVARFPQGEQGLTTQAQWRAVIDRIADHRDPFAALLARVDREFESERDDTLP
PWLRFVRTTSHMLAPAMLAPARLPAASGGLGAALGSISRSGGRALREALGGAPEQGRLTLERDAALRDAL
VDYERRVAALAADALAGPGAAYRLAADFHGFGVDPSVQASAMRAADSALRDVKRLAGDRDVGGDVVWSLV
GGPLRALIAYVERQASCALQDDWERDVLWPLRRAATRDDVEGLLYGPQGAIWAFVDGPAKPFVRVGAARA
SALDTLGYRLPFTDAFLPLIDDAAARRVAQARRDAERRAQQQAALELDKRIASLGKQIDALRAQTVRFGI
VAQPTDVNPDAQAKPFETVLTLQCAPQARTLTNYNLRVSEQIDWQPDRCGDATLRISLGGVTLVRRYAGS
LGVARFVQDFRYGVRRFTPRDFPDAKAQLQRLGVRHIDVRYDFSGHDALLAHVGRIDALERARRDDLARQ
RRAANRQDDDAGGATAIARAAASVANAPGAALPRRIGVCWGDPAHDRPDGDGAQP
 
Nucleotide Sequence: 4578 bp     [Download]
>gi|77358719|ref|NC_006349.2|:c743269-738692 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
GTGCGCGGGCGCACCCGCGGCCGACGTCGACGACGCGCTGTTCGCGGTGTGCGCGTGGATCGACGAGGCG
CTGCTGAACAGCGGCTGGGACGATGCCGATCGCTGGACGCTGCGGCTGCTGCAAAAGCGCTACTTCGATA
CGTCGCACGCGGGCGTCGTGTTCTTCGAACGCCTCGGCACGCTCGACGGCGCGCGCGCGAGCGTGCTCGA
GGTCTACCTGCTGTGCCTGCGGCTCGGCTTTCGCGGCCGCTACGGCTACGACGGCGGCGACGGCCCGCTC
GACGCGATCCGCCAGCGCGCGCTCGATGCACTGTCGGCGCACGCGCCGCCGTGCGCCGCGGGCGAGCCGC
CGTTTCCCGCCGCCTATGCGCACGCCGGCCCGCACGCCGCCGCCGCGAAAGCGCGCACGCGCCGCCGGAT
CGCGCGCGCGGGGCTGAGCGTCGGGCTGCCGCTCGCCATCCTGCTGTCGCTCTATCTGATCTATCACGTC
GTCATCGTGCGGATGGTCGACGCGGTGTACCCCAGGCTGCAATGAAGACTCTCGGCATGATGATCGCGCG
GATCGCCGCGCTGCTCGCGCTCGCCGCGCTCAGTTGGGCGAGCGCGCTCTATTTCGACTGGCCGCTCTGG
TGCGCGCCCGCCGTGTTCTGCGCGGCGCTCGCCGGATGGCTGCTGTGCCGCGTCGCGCGCCGCGCGCTGC
GCGCGGTTCGTGCGCGCGCGCAGCTCGCACGGCTCGACGCATCCGAGCGCCTGCCCGCGGCCGACGCGCC
GGAGCTGCGCGTCGCCGCGCGCTGGCGCACCGCGCTCGCCGCGCTCGGGCGCGCGCAGCCCGCGCCGCGC
CTGCGCGGCCGGCCGCGCGACGCGCTGCCGTGGTATCTCGTGATCGGCCCCGAGGGCGCGGGCAAGACAA
CCGCGCTCGCGCGCGCGCGCCTCGCGTCGCCGCTGCGGCACGCGCGCGACGACGCGGCCATCGCGCCGAC
CGAGGACTGCGACTGGTGGTGCTTCGACGACGCGGTCGTGCTCGATCTCGCGGGCCGCTTCGCCGCGCCC
GGCGCGACCGACGACGATCGCCGCGCATGGCACGCGCTCCTCGAGCAGCTCGGCCGCGCGCGTGCGCGCC
GGGGCGTGAACGGCGTCGTGGTCGCGATCGACGCGCCGCGCCTCATCGAAGCGAGCCGCGATGCGCTGAC
GATCGAAGGCAGCGCCATTCGCGAACGGCTCGAGCAACTGATCCGCCTGTTCGACCGGCGCTTTCCGGTG
TACGTGCTCGTCACGCAATGCGACCGGCTCTACGGCTTCGACGAATGGGCCGCGCAGCTCGCGCCGGAAC
AACGCGAGCGCGCGTTCGGCTATCTCGGCGATCACGACGCGGATGCGTTCGTCGCGCGCGCGCTCGACAG
CCTCGACGCACGGCTCGGCGCGCTGCGCGTCGCGCTGGCGGCGCGCGGCGAGCCGCCGTCGCCGCGCGCG
CTGATGCTGCCGCACGAACTCGCGTGCCTGCGGCCCGCGCTCGAGGCGTTCGCACGCGCGGCGTTCGGCC
CGAACGTCTATCAGGAAACACCGTATCTGCGCGGGCTGCTGTTCGCGAGCGGCCGGCAGGCGGGCGGCGC
GCCGTCGCTGACGCTGCCCGACTGGCTCGACGCCGCGCCGGCGCGCACGCCCGGCGATGCGGGCCTGTTC
CTGCACGACGTGTTCGCGCGCGTGCTGCCGGGCGAGCGCGACGCGTGGCTGCCCGTCGAGCGGCCGAGCC
GCTCGCGGCTCGTGCTGCGGCGCCTCGCGCTCGCCGCGTGGCTCCTCGCGAGCGTCGCGGCCGGGCTGCT
GATGAGCGCATCGTTCGTCGGCGACATGCGAACCGTCGAGCTGGTCCGCCGCGACTATCCCGCGCATCCG
CGCTTCACCGGCGAATTCGCGCACGACACGGCGACGCTCGCGCGGATCGGCCGCGTGATCGCCGACGTCG
AGCGGCGCGACGAGCGGCGGCTCGTGCGCCCGCTCGCCGGCGCGACGCCCGTCGGCCGGCTCGAAGCGGA
ACTCAAGCGCCGCTACGTCGCACACTATCGGCGCTCGATCGAACCCACCGCCGATCGGCTGTTCTTCGGC
AAGCCGGACGGCGCGAGCGACATGCGCGCGGCCAACGATGCGCGGCTCGCCGCGCGCATCCGCAATCTGG
TCCGCTACGTGAACCTGATGCAGGCGCGCCGGCGCGGCGCGGATCGCGAGACGCTCGCGCAAATGCCCGC
ACCGGCGGTCGCGCGCGCGACGGATGGCGGTGGCGCTCGCGGAGTGGACAGTGTGGGTGTTTCTGGTGTT
TCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTG
TTTCTGGTGTTTCTGGCGGTGTAGGCGGTGTAGGCGGTGTAGGCGGTGCGCGCGCCGCGGAAGGTGCGGG
TCGCGCCGTCCGCGCGAGCGGCGGACGGCGCGCAGGCGACGCGCGCGCCGCGCGCGGCATGCGCGGCGCC
GCCGGCAACGCCGGCGCCGGCGCTGAAATCGCACCCGCCGCAGACGGCGTTCGCGATCGCGACGAAGGGT
TTGCGCGCGTCAGCGCGCTCGCCGTCGACCTGATCGCGTGGAGCGCGCCCGACGATCGCGCGCTCGCCGC
GCGCGTCGCGGCCGCGCAGGCAGAGCTCGAACGGCTCGCGTACCGCGATCCGGACGGCGCGTGGCTGCTC
GCGCTACCGGATGCCTCGATGCCGCGCGACGTGACGCTCGCCGATTTCTGGCCCGCCGCCGAGCCGCGCA
CGCTGCCCGACGCACAGCCCGCCGCGCTGCGCGACGTGCGCGTGCCCGCCGCGCTGACGGCCGCGCATCG
CCCGGCCATCGATGCGTTCCTCGACGAGATGGCGCAGGCGGTCGCGAACCGGCCGAAGTTCGCGTTCCAT
CGCGACGCGTTCGACACGTGGTACCGCGCACGGCGCATCGACGCATGGCGCGACTTCGTCGCACGCTTCC
CGCAGGGCGAGCAAGGGCTGACGACGCAAGCGCAATGGCGCGCGGTGATCGACCGGATCGCCGATCACCG
CGATCCGTTCGCGGCATTGCTCGCGCGCGTCGATCGCGAATTCGAATCCGAGCGCGACGACACGCTGCCG
CCGTGGCTACGGTTCGTGCGCACGACATCGCACATGCTCGCCCCCGCGATGCTCGCGCCCGCGCGCCTGC
CCGCGGCGAGCGGCGGCCTGGGCGCCGCGCTCGGCTCGATCTCGCGCAGCGGCGGACGCGCGCTGCGCGA
AGCGCTCGGCGGCGCACCCGAGCAAGGCAGGCTCACGCTCGAGCGCGACGCCGCGCTGCGCGACGCGCTT
GTCGACTACGAGCGGCGCGTCGCCGCGCTCGCCGCCGACGCGCTCGCGGGCCCCGGCGCCGCGTACCGGC
TCGCGGCCGATTTCCACGGCTTCGGCGTCGATCCGTCCGTCCAGGCTTCCGCGATGCGCGCGGCCGACAG
CGCGCTGCGCGACGTCAAGCGGCTCGCGGGCGATCGCGACGTCGGCGGCGACGTCGTCTGGAGCCTCGTC
GGCGGCCCGCTGCGCGCGCTGATCGCGTATGTCGAGCGGCAGGCGTCGTGCGCGCTGCAGGACGACTGGG
AGCGCGACGTGCTGTGGCCGCTCAGGCGCGCGGCGACGCGCGACGACGTGGAGGGTCTGCTGTACGGCCC
GCAAGGCGCGATCTGGGCGTTCGTCGACGGCCCGGCGAAGCCGTTCGTGCGTGTCGGCGCGGCGCGTGCG
TCGGCGCTCGACACGCTCGGCTACCGGCTGCCGTTCACCGACGCGTTCCTGCCGCTCATCGACGACGCGG
CCGCCCGGCGCGTCGCGCAAGCGCGGCGCGACGCCGAGCGGCGCGCGCAACAGCAGGCGGCGCTCGAGCT
GGACAAGCGGATCGCATCGCTCGGCAAGCAGATCGACGCGCTGCGCGCGCAAACGGTGCGCTTCGGGATC
GTCGCGCAGCCGACCGACGTGAACCCGGATGCGCAGGCCAAGCCGTTCGAAACCGTGCTGACGCTGCAAT
GCGCGCCGCAGGCGCGCACGCTGACGAACTACAACCTGCGCGTGTCCGAGCAGATCGACTGGCAACCCGA
TCGATGCGGCGACGCGACGCTGCGCATCTCGCTCGGCGGCGTCACGCTCGTGCGCCGTTACGCGGGATCG
CTCGGCGTCGCGCGCTTCGTCCAGGACTTCCGCTACGGCGTGCGCCGCTTCACGCCCCGCGATTTCCCGG
ACGCGAAAGCGCAGCTTCAACGTCTCGGCGTGCGCCACATCGACGTGCGTTACGACTTCTCCGGGCATGA
CGCGCTGCTCGCGCACGTCGGTCGGATCGACGCGCTCGAACGCGCGCGCCGCGACGACCTCGCGCGGCAG
CGGCGCGCCGCGAACCGGCAGGACGACGACGCGGGCGGCGCGACGGCGATCGCGCGGGCGGCGGCGTCCG
TCGCGAATGCGCCGGGCGCCGCGCTGCCCCGCCGCATCGGCGTGTGTTGGGGGGACCCGGCGCACGACAG
GCCCGATGGCGACGGCGCGCAACCGTGA
 Primer design