SecReT6
Protein ID: 77459624
SecReT6 ID97
T6SS typei4a
Gene symbol-
Locus tagPfl01_3402
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]3879038..3882859 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ3KAR4
KEGG IDpfo:Pfl01_3402
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.50E-38, Aligned region: 116..353
Protein Sequence: 1273 a.a.     [Download]
>gi|77459624|ref|YP_349131.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MSTLTIVAWVVAILLLLVIIAVAVWWLRTQSGAAIRSFYAAVRHMEQEQGAHDRYQMPWLLMLGDETQGA
QLATQWRLQPTDKPAWFGRWWSDSEGAVLVVPQALFLPEDGMHLQRGGWWRLLGLILRLRSKRPLDGVIW
TVPVSRLSNLEQATQLGLAARRRFIDLLQRFGLSLPVYVVITGLEELPGFQELISALPDEARDRTLGWSS
PYARDAVWQGQWSDQALDRLHRAVAEAVIEIGTLSGHLSADLYALPERLETLRRGLQNVLEPVFQGNAQG
EAPCFRGVYLTANQPADDALDGFSADDSGLQQSAFVRQLWRQRIVGERGLAQGVPRLLRLRQRWQRVTAG
VALVVGVVWAVAMLWVWQASVKDAHELARLLQGAQKNYVAVIDDEHRVEPTRRNVQNFWRVLERAPHWHY
VSLAFPTSWFSSLDGRLEQEVFRSTQRHMLQPLHDLLVAELAKIKAIRATDRRTSVESEDPAQWQNYQKA
TDLVERALRLEQQNQLFAQVQNDQRAPLEDLAQLSNSALSLNLNVGTLPHAAYYNRLLAASDGGDLQALD
LSVERPLIVSNFTGLMERWLDQYFLADNFVSKAGYLKLHLEQLEAGSGNSLAELEDLRALIDDLQAAIAL
TNSTWSRGKGQELVPGYREFLDKVRKSSLLGPAVEQQLDAQAGKLQQSFRDQWIAQVGSRGNLLVQQGSG
QLALQDQVVKLNNAVQALFKRDFVSIALRASQDSVNRQGQTVDGDDLNESLNYFASYKNYVAEELPRIPP
AYREALLQAAETAAAQAMWLSLKDHDDQTHPYAVFNVQAVQAMNLQKAFIEVHRSDLAARLQGALNRRAM
AQIVGGLDEITAQPLFGGRTEISQWDGSKNLGLQLYGASDVQDLKLSLKQQFNTMLGITERRAPALEWLK
TQQGNLSALDYERVTQFSALNDELLKYKDSNPASSPAQIEQLVSRDFIEMDTGSCVQVLQTANLTGGRGT
LAMRAVELQQSALQRCQFLQQQQAAAAWNELAGYFNQYLADRFPFANGVQAQDADPARVQHFLEIIDKRL
PVAQAGLVLSQTPERLAAEDFLNRVKQASVWLTPLFVRDKSGILGVELDVRWRTDREEEKGADQVIAWGL
LAGNQQINYPAADQPNLRWMPGQPIRLTLRWARNGKERPVNDPLQPNLVVRDLEAGWEYGGPWSLLRLMR
AHFSVQRQPSMDYTDFPLSLRLPVTAQNDSVTSEFTRMFVRVSLMSQGSKLPLSIPPLPTRAPRSPFQVT
GTTAALEAQKEDL
 
Nucleotide Sequence: 3822 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c3882859-3879038 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGAGTACCCTGACGATCGTGGCCTGGGTGGTCGCCATCCTTCTGCTGCTGGTGATCATCGCGGTGGCGG
TGTGGTGGCTGCGCACCCAGAGCGGCGCGGCGATTCGCAGTTTCTACGCCGCCGTGCGGCACATGGAGCA
GGAGCAGGGCGCCCACGACCGTTATCAGATGCCGTGGCTGCTGATGCTCGGCGATGAAACCCAGGGCGCC
CAGCTCGCCACTCAATGGCGTTTGCAACCCACCGACAAACCGGCGTGGTTCGGCCGTTGGTGGTCGGACT
CCGAAGGCGCGGTGCTGGTGGTGCCGCAGGCGCTGTTTCTGCCGGAAGACGGCATGCACCTGCAACGCGG
CGGCTGGTGGCGTCTGCTCGGGTTGATCCTGCGCCTGCGCAGCAAGCGCCCGCTGGACGGGGTGATCTGG
ACAGTGCCGGTCAGTCGGTTGAGCAATCTGGAGCAGGCCACGCAACTCGGTCTGGCGGCGCGTCGGCGTT
TCATCGATCTGTTGCAGCGCTTTGGTCTGAGCCTGCCGGTGTACGTGGTCATCACCGGGCTGGAAGAACT
GCCGGGATTTCAGGAACTGATCAGCGCGTTGCCGGACGAGGCTCGCGATCGCACCTTGGGCTGGTCGTCG
CCCTATGCCCGCGATGCAGTGTGGCAGGGGCAATGGAGCGATCAGGCGCTGGATCGGCTACACCGCGCGG
TGGCGGAGGCGGTGATCGAAATCGGCACCTTGTCCGGGCATTTGAGTGCGGATCTGTACGCCTTGCCGGA
ACGTCTGGAAACTCTGCGGCGTGGTTTGCAGAACGTGCTGGAACCGGTTTTTCAAGGCAACGCTCAGGGC
GAGGCACCGTGTTTTCGTGGCGTTTACCTGACGGCCAATCAGCCGGCCGATGATGCGCTGGACGGTTTTT
CTGCCGATGACAGCGGCCTGCAGCAAAGTGCGTTTGTGCGTCAGTTGTGGCGCCAGCGAATAGTCGGCGA
ACGTGGACTGGCCCAAGGCGTGCCGCGCCTGTTGCGCTTGCGCCAGCGCTGGCAACGAGTGACTGCCGGG
GTGGCGCTGGTGGTCGGGGTGGTCTGGGCGGTGGCGATGCTCTGGGTCTGGCAGGCGTCGGTCAAGGACG
CGCATGAACTGGCGCGGCTGCTGCAAGGCGCGCAGAAGAATTACGTGGCGGTGATCGATGACGAGCATCG
GGTCGAGCCGACCCGGCGCAACGTGCAGAACTTCTGGCGGGTGCTGGAACGGGCGCCGCACTGGCACTAC
GTTTCGCTGGCCTTTCCGACGTCGTGGTTTTCCTCGCTGGACGGGCGACTCGAACAGGAAGTGTTCAGGT
CGACCCAGCGCCACATGCTGCAACCGCTGCACGATCTGCTGGTCGCGGAGCTGGCGAAAATCAAGGCGAT
CCGCGCCACCGACCGGCGCACCAGCGTCGAAAGCGAAGACCCGGCGCAGTGGCAGAATTATCAGAAGGCC
ACGGATCTGGTCGAGCGAGCCTTGCGTCTGGAACAACAGAACCAGTTGTTCGCCCAAGTGCAGAACGATC
AGCGGGCGCCGCTGGAAGATCTGGCGCAACTGAGCAACAGCGCGCTGTCACTCAACCTCAACGTCGGCAC
CTTGCCCCATGCCGCCTACTACAACCGGCTGCTGGCGGCCAGTGATGGCGGCGACTTGCAGGCGCTGGAT
CTGAGCGTTGAACGGCCGTTGATCGTCAGCAATTTCACCGGGCTTATGGAGCGCTGGCTCGATCAGTATT
TTCTGGCCGACAACTTCGTCAGCAAGGCCGGCTACCTCAAGTTGCATCTGGAACAGCTTGAAGCCGGGAG
TGGCAACAGCCTTGCCGAACTGGAAGACCTGCGCGCGCTGATCGATGACTTGCAAGCGGCGATCGCCCTG
ACCAACTCGACCTGGAGTCGCGGCAAGGGGCAGGAGCTGGTGCCGGGTTATCGCGAGTTTCTCGACAAGG
TGCGCAAGAGTTCATTGCTCGGCCCGGCCGTGGAACAGCAGCTCGATGCGCAGGCCGGCAAGTTGCAGCA
GAGTTTTCGCGATCAATGGATCGCCCAAGTGGGTTCGCGGGGCAATCTGCTGGTGCAGCAGGGCAGCGGG
CAACTGGCATTGCAGGATCAGGTGGTCAAGCTCAACAACGCGGTGCAGGCGCTGTTCAAGCGTGACTTCG
TTTCAATTGCCCTGCGTGCCAGCCAGGACAGCGTCAACCGGCAAGGCCAGACCGTGGATGGCGATGACCT
CAACGAGTCGCTGAATTATTTCGCCAGCTACAAGAACTACGTTGCCGAAGAGCTGCCGCGCATTCCGCCG
GCCTACCGTGAAGCATTGCTGCAAGCGGCCGAAACCGCCGCCGCACAGGCGATGTGGTTGAGTCTCAAGG
ATCATGATGATCAGACTCATCCTTACGCGGTGTTCAACGTGCAGGCGGTACAGGCGATGAACCTGCAAAA
AGCCTTTATCGAAGTCCATCGCAGTGATCTGGCGGCGCGTCTGCAAGGGGCCTTGAATCGCCGGGCGATG
GCGCAGATCGTTGGCGGGCTGGATGAAATCACCGCGCAGCCGCTGTTCGGTGGCCGCACGGAAATCAGCC
AGTGGGACGGCTCGAAAAACCTCGGCCTGCAACTCTATGGCGCGAGCGACGTGCAGGATCTGAAGCTGAG
CCTCAAGCAGCAATTCAACACCATGCTCGGCATCACCGAGCGTCGCGCCCCGGCGCTGGAATGGTTGAAG
ACCCAGCAGGGCAATCTGTCGGCGCTGGATTACGAGCGCGTGACCCAGTTCAGCGCGCTCAACGACGAAT
TGCTCAAGTACAAGGATTCCAACCCGGCCAGTTCGCCGGCGCAGATCGAGCAACTGGTCAGCCGCGACTT
CATTGAAATGGACACCGGCTCCTGCGTGCAGGTGTTGCAGACCGCCAATCTGACCGGCGGGCGCGGCACC
CTGGCGATGCGGGCGGTGGAGTTGCAACAGTCGGCCCTGCAACGCTGCCAGTTTCTGCAACAGCAACAGG
CGGCTGCCGCGTGGAACGAACTGGCCGGCTACTTCAATCAGTACCTGGCTGACCGCTTTCCGTTCGCCAA
CGGCGTGCAGGCGCAGGATGCCGACCCGGCGCGGGTCCAGCACTTTCTGGAAATCATCGACAAGCGCTTG
CCGGTGGCCCAGGCCGGACTGGTCCTGAGCCAGACCCCGGAGCGGCTGGCGGCGGAAGATTTTCTCAACC
GGGTGAAACAGGCCAGCGTCTGGCTGACGCCGCTGTTCGTACGCGACAAGAGCGGGATTCTCGGCGTCGA
GCTGGACGTGCGCTGGCGCACTGATCGCGAAGAAGAGAAGGGCGCCGATCAGGTGATTGCCTGGGGCTTG
CTGGCCGGCAATCAGCAGATCAACTATCCCGCTGCCGATCAGCCGAACCTGCGCTGGATGCCCGGCCAGC
CGATCCGCCTGACCCTGCGCTGGGCGCGCAACGGCAAGGAGCGTCCGGTCAACGACCCGCTGCAACCAAA
CCTGGTGGTGCGCGATCTGGAGGCCGGCTGGGAGTATGGCGGGCCGTGGTCGCTGCTGCGCCTGATGCGT
GCGCACTTCTCGGTACAACGCCAGCCGAGCATGGATTACACCGATTTTCCGTTGAGCCTGCGCCTGCCGG
TTACCGCGCAGAATGACAGCGTGACCAGCGAATTCACCCGGATGTTCGTGCGCGTGTCGCTGATGAGCCA
GGGCTCGAAACTGCCGTTGTCGATTCCGCCGTTGCCGACCCGCGCGCCGCGTTCACCGTTCCAGGTGACC
GGCACCACCGCCGCCCTTGAAGCCCAGAAGGAGGATTTGTGA
 Primer design