SecReT6
Protein ID: 77461796
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5575
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6244619..6245620 [-]
ProductSerine/threonine protein kinase
NoteStk1
UniProt IDQ3K4J2
KEGG IDpfo:Pfl01_5575
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 1.20E-37, Aligned region: 54..292
Pkinase_Tyr [PF07714], Evalue: 4.90E-21, Aligned region: 55..308
APH [PF01636], Evalue: 2.60E-05, Aligned region: 99..146
APH [PF01636], Evalue: 2.60E-05, Aligned region: 160..205
APH [PF01636], Evalue: 2.60E-05, Aligned region: 283..283
Protein Sequence: 333 a.a.     [Download]
>gi|77461796|ref|YP_351303.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MTEIESSVDDLLMSEEQANNLTYFAFAKQHNAEPALAPTKASVGALPDVLAGRYHLERLLGAGGMGAVYR
ARDLLHEQFGDPDPYIALKILSEEFAESPDASALLYSEFALTRRLRHDNVLRPHTFEVDTDCQRAFITME
LMRGLTLDKLLCERPLGLPWKELRDIALPLLDALAYAHRRGVLHGDMKPSNVMLSEDGVRLFDFGLGQAE
EGILPGLPHLSRERFNAWTPGYAAPELLEGQPLSASADVYGVACVIYELAGGKHPFRRLPSTQARDEHLE
RELQAPANLPTHCWPALRTALAFDAAERNISAEQLRDALGATSSWLQRLRLRA
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6245620-6244619 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGACTGAAATCGAATCCTCAGTCGACGACTTGCTGATGAGCGAAGAGCAGGCCAACAACCTGACTTATT
TCGCCTTCGCCAAGCAACATAATGCCGAACCCGCGCTGGCGCCGACCAAGGCCAGCGTCGGCGCACTGCC
GGATGTTCTGGCAGGCCGCTACCACCTCGAGCGTCTGCTCGGGGCCGGTGGCATGGGAGCGGTTTACCGG
GCCCGGGATCTGCTGCACGAGCAGTTCGGCGATCCCGATCCTTACATTGCGCTGAAAATCCTCAGCGAAG
AATTTGCCGAGTCGCCGGACGCCAGTGCCTTGCTCTACAGCGAGTTTGCCCTGACCCGACGCCTGCGCCA
CGACAACGTGCTGCGACCGCACACGTTCGAAGTCGACACCGATTGCCAGCGGGCCTTCATCACCATGGAA
CTCATGCGTGGCCTGACTCTGGACAAACTGCTCTGCGAGCGGCCGCTGGGCCTGCCGTGGAAAGAACTGC
GCGACATCGCGCTGCCGCTGCTCGACGCGCTGGCCTACGCCCACCGTCGCGGCGTGCTGCACGGTGACAT
GAAGCCGAGCAACGTCATGCTCAGCGAAGACGGCGTGCGCCTGTTCGACTTCGGTCTCGGGCAAGCCGAG
GAGGGCATCCTGCCCGGCCTGCCGCACCTGAGCCGCGAGCGCTTCAACGCCTGGACACCGGGCTACGCCG
CCCCCGAACTGCTTGAGGGCCAACCGCTGTCGGCCAGCGCGGACGTGTACGGCGTGGCCTGCGTGATCTA
TGAACTGGCGGGCGGCAAACACCCGTTCCGCCGCTTGCCCTCGACCCAGGCCCGTGACGAACACCTGGAG
CGCGAGCTGCAAGCCCCGGCAAATCTACCGACACACTGCTGGCCCGCGCTGCGCACCGCGCTGGCCTTTG
ACGCGGCAGAGCGCAACATTTCTGCCGAACAATTGCGTGACGCCTTGGGCGCCACTTCGTCCTGGCTGCA
GCGTTTGCGACTGCGGGCGTAA
 Primer design