SecReT6
Protein ID: 77461797
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5576
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6245617..6246345 [-]
ProductSer/Thr phosphatase
NoteStp1
UniProt IDQ3K4J1
KEGG IDpfo:Pfl01_5576
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.80E-17, Aligned region: 19..205
PP2C [PF00481], Evalue: 7.50E-15, Aligned region: 31..205
SpoIIE [PF07228], Evalue: 3.40E-09, Aligned region: 35..241
Protein Sequence: 242 a.a.     [Download]
>gi|77461797|ref|YP_351304.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MLVASPWRSAARTDPGKVRSRNEDAFLDTPQHGLWVVADGMGGHQGGDIASQLIVASLAELPQHEDFDER
LKAIRQCLHWLNRRLGQELTVTAGRHDSIMGSTVVALLVDGNRAACIWAGDSRCYMWRGQRLYQLSKDHS
LQQQLIDEQQMSVEQAAAHPAAQALTRAVGAAEQLTLDVLELEVYPGDVFLLCSDGLYQGLSSDALGNAL
SLAAPHVALERLFDGALRGAARDNLTAVVIRQ
 
Nucleotide Sequence: 729 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6246345-6245617 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGCTGGTGGCCAGTCCCTGGCGCAGCGCGGCGCGAACCGACCCGGGCAAGGTGCGGTCGCGCAACGAAG
ATGCCTTCCTCGACACCCCGCAGCATGGGCTGTGGGTGGTCGCGGACGGCATGGGCGGTCATCAGGGTGG
CGACATCGCCAGCCAGTTGATCGTCGCCAGCCTGGCTGAACTGCCGCAGCACGAAGATTTCGACGAACGC
CTCAAAGCCATCCGCCAGTGCCTGCACTGGCTGAACCGGCGCCTGGGGCAGGAGTTGACCGTCACCGCCG
GGCGCCACGACAGCATCATGGGCAGCACCGTCGTGGCGCTGCTGGTGGACGGCAATCGCGCGGCCTGCAT
CTGGGCCGGCGACAGCCGTTGCTACATGTGGCGCGGGCAGCGGTTATATCAGCTGTCGAAGGATCACTCG
CTGCAGCAACAACTGATCGACGAACAGCAGATGAGCGTCGAACAGGCAGCGGCGCACCCGGCGGCCCAGG
CCCTGACCCGGGCGGTCGGCGCGGCGGAACAGTTGACCCTGGATGTGCTGGAACTCGAGGTCTATCCCGG
TGATGTGTTCTTGCTGTGCAGCGATGGTTTGTATCAAGGCCTGAGCAGCGATGCCCTCGGCAATGCTCTC
AGCCTGGCGGCGCCACACGTGGCGCTGGAACGTCTGTTCGACGGCGCCCTGCGGGGTGCCGCTCGCGACA
ACCTGACGGCCGTGGTGATCCGCCAATGA
 Primer design