SecReT6
Protein ID: 77461798
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5577
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6246345..6249884 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ3K4J0
KEGG IDpfo:Pfl01_5577
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.70E-80, Aligned region: 502..792
ImcF-related_N [PF14331], Evalue: 3.70E-76, Aligned region: 196..451
DUF1215 [PF06744], Evalue: 4.60E-35, Aligned region: 628..650
DUF1215 [PF06744], Evalue: 4.60E-35, Aligned region: 914..1038
DUF3485 [PF11984], Evalue: 0.00083, Aligned region: 196..259
DUF3485 [PF11984], Evalue: 0.00083, Aligned region: 910..955
AAA_16 [PF13191], Evalue: 0.0096, Aligned region: 127..256
AAA_16 [PF13191], Evalue: 0.0096, Aligned region: 278..323
AAA_16 [PF13191], Evalue: 0.0096, Aligned region: 804..891
Protein Sequence: 1179 a.a.     [Download]
>gi|77461798|ref|YP_351305.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MKKFFKKVGAFLRQTWVWTLLLVLFVALLVWFVGPLLAVDDYKFWESATSRLLTISVLFLIWGLTMVFVS
WRAGIRKKAVEETEDGQDRIRREELIDEEQKELKERFKDALKTLKTSSLYRGRSERWRNDLPWYLLIGPQ
ASGKTSLLDFSGLEFPINKIDRKLTRDTHGTRHCDWYFADHGVLIDTAGRYLTQPDAEVDGSAWTTLLEL
LRKRRRGRPLNGVLVTIPVETLTGGSEQDIETLARQVRARLQDVYQKLHVDVPVYLVLSKADKLLGFDEF
FDQLTREESDQVLGTSFRKDQVGTDVTVLRNEFEELLRRLNSQVIMRMHSERDTQRRGRILDFPHQMGQI
GERLCLLVDMAFTGNRYQRATQLRGFYLTSAPHLTQEMDSTTAGIGASLGMSAGVLPTLRSGRSRFIHHL
LSRVIFPEADLAGLDKRERSRIHWGQRALYVGALGALVLFGMLWAGGFSANYERLENLRNLAQNWTQQRT
LLSPRDDAMGALKTLDTSYAATQVFPNKSDVSYHERVGLYQGQDVSPVVKEAYERELEKQLLPRVATMLE
GQIRANMKDREKLINSLRAYLMLNMKDRRDAAWLKDWIAADWSQRYTGNTAVQNGLNTHLERLLQQPFIY
PLNEQLVTQARQVLRSESLATVVYRMLREQARNLPDYRFSQHLGPQGSLFIGTEYVIPGFYTQTGYQQYF
SVQGASLVTDILRDNWVLGEGAGISDMDLRRLMVELEQLYFRDYANYWSEAVGQVALPPISDAGEGAEQL
AGLTSANSPVLALLTEVRENTRFPAAADPVDEAGDAADALAGQKGKLGKVGKLAAAAADKASALNVAKNL
PDTAKKSLQRRFEPLHKLLDDNNGPAADLTPAFTALNDLQLQLAGLARSSTPEQAAFELAKTRMSGQRDA
LTNLRNASGRLPRPLSVWFNVLAEDSWRLVLNDAYQYLNGRYQNELYSVYGKTINKRYPFSASSTSDVAI
SDFREFFRAQGTIDRFFDSYMRPFVSGDPGNYRMRSIDGRSLPVSKVFLDQMAAALNIRQSFFSINPAEP
TVQFKLEPYTLDPAVSRSEFKFGDKTMEYRHGPILPMTFKWPTDAEDGRTSLVMDKMAGRPIGIEKNSGP
WSLFRLFDLMQTEYLTGRDVLVLKADVGGLRANYLLTSQRTPNPFDMGVMRTFRMPVQL
 
Nucleotide Sequence: 3540 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6249884-6246345 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGAAAAAGTTTTTCAAGAAAGTCGGCGCCTTCCTGCGCCAGACCTGGGTCTGGACCTTGCTGCTGGTGC
TGTTCGTGGCGCTGCTGGTGTGGTTCGTCGGCCCGTTGTTGGCAGTGGATGACTACAAGTTCTGGGAAAG
CGCGACCTCGCGTCTGCTGACCATCAGCGTGCTGTTCCTGATCTGGGGCCTGACCATGGTCTTCGTCAGC
TGGCGCGCCGGGATCCGCAAGAAAGCCGTCGAAGAAACCGAAGACGGCCAGGACCGTATCCGCCGCGAAG
AGTTGATCGACGAAGAGCAGAAAGAGTTGAAAGAGCGTTTCAAGGACGCCCTGAAAACCCTCAAGACTTC
GAGCCTGTACCGCGGCCGCAGCGAGCGCTGGCGCAATGACTTGCCGTGGTACTTGCTGATCGGCCCGCAG
GCCAGCGGCAAGACCAGCCTGCTGGACTTCTCCGGGCTGGAATTCCCGATCAACAAGATCGACCGCAAGC
TGACCCGCGACACTCACGGCACCCGTCATTGCGACTGGTACTTCGCCGACCACGGTGTGCTGATCGACAC
CGCCGGCCGCTACCTGACCCAGCCGGATGCGGAAGTCGACGGCAGCGCCTGGACCACCTTGCTGGAACTG
CTGCGCAAGCGTCGTCGCGGTCGTCCGCTGAACGGCGTGCTGGTGACCATTCCGGTGGAAACCCTGACCG
GTGGCAGCGAACAGGACATCGAAACCCTGGCCCGCCAGGTGCGTGCGCGTCTGCAAGACGTCTATCAGAA
GCTGCACGTCGATGTGCCGGTGTATCTGGTGCTGAGCAAGGCCGACAAGCTGCTGGGCTTCGACGAGTTC
TTCGATCAACTGACCCGCGAAGAAAGCGATCAGGTGCTGGGTACCAGTTTCCGCAAGGATCAGGTCGGCA
CCGACGTGACGGTACTGCGCAACGAGTTCGAAGAGCTGCTGCGTCGCCTCAACAGCCAGGTGATCATGCG
CATGCACTCCGAGCGCGACACCCAGCGCCGTGGCCGCATCCTCGACTTCCCGCACCAGATGGGCCAGATC
GGCGAGCGTCTGTGCCTGCTCGTCGATATGGCGTTCACCGGCAACCGCTACCAGCGTGCGACACAACTGC
GTGGTTTCTACCTGACCAGCGCACCGCACCTGACTCAGGAAATGGATTCGACCACCGCCGGCATCGGCGC
GAGTCTGGGCATGAGCGCCGGCGTGTTGCCGACACTGCGCAGCGGTCGTTCGCGTTTCATCCATCATTTG
CTCAGCCGGGTGATTTTCCCGGAGGCCGATCTGGCCGGTCTGGACAAGCGCGAACGCAGCCGCATCCACT
GGGGCCAGCGTGCGTTGTACGTCGGCGCGCTGGGTGCTCTGGTTCTGTTCGGCATGCTCTGGGCCGGTGG
ATTCTCGGCCAACTACGAGCGTCTGGAAAACCTGCGCAACCTGGCGCAGAACTGGACGCAGCAACGCACT
TTGCTATCGCCACGCGATGACGCCATGGGCGCACTGAAAACCCTCGACACCAGCTACGCCGCCACCCAGG
TGTTCCCGAACAAGAGCGACGTGTCTTACCACGAGCGTGTCGGTCTGTATCAAGGCCAGGACGTCAGTCC
GGTGGTCAAGGAGGCGTACGAGCGCGAGCTTGAAAAGCAACTGCTGCCGCGCGTCGCGACGATGCTCGAA
GGCCAGATCCGCGCCAACATGAAGGACCGCGAAAAGCTGATCAACAGCCTGCGTGCGTACCTGATGCTGA
ACATGAAGGATCGTCGTGACGCGGCATGGCTCAAGGACTGGATCGCGGCTGACTGGTCGCAGCGCTACAC
CGGAAACACTGCGGTGCAGAACGGTCTGAACACGCACCTTGAGCGTCTGCTGCAGCAGCCGTTTATCTAC
CCGCTCAACGAGCAACTGGTGACCCAGGCGCGTCAGGTGCTGCGCAGCGAATCGCTGGCGACCGTGGTTT
ACCGCATGCTCCGCGAGCAGGCGCGCAACCTGCCGGATTACCGTTTCAGCCAGCACCTCGGGCCGCAAGG
CTCGCTGTTCATCGGTACCGAATACGTGATCCCGGGCTTCTACACCCAGACCGGTTATCAGCAGTATTTC
TCGGTACAAGGCGCGTCGCTGGTGACCGACATCCTGCGTGACAACTGGGTGCTGGGCGAAGGCGCCGGCA
TCAGCGACATGGACTTGCGTCGCCTGATGGTCGAGCTGGAGCAACTGTACTTCCGCGATTACGCCAACTA
CTGGAGCGAGGCCGTTGGCCAGGTAGCACTGCCGCCGATCAGCGATGCCGGTGAAGGCGCCGAGCAACTG
GCGGGCCTGACCTCGGCCAACTCGCCGGTGCTGGCGCTGCTGACCGAAGTGCGCGAGAACACCCGCTTCC
CGGCAGCTGCCGATCCGGTGGACGAGGCGGGTGACGCGGCTGATGCGCTGGCCGGACAGAAAGGCAAACT
GGGCAAGGTGGGCAAACTCGCCGCGGCGGCAGCGGATAAGGCCTCGGCCCTGAACGTGGCGAAGAACCTG
CCGGACACCGCCAAGAAGTCCCTGCAACGTCGCTTCGAGCCGCTGCACAAGTTGCTCGACGACAACAACG
GCCCGGCCGCTGACCTGACCCCGGCCTTCACCGCGCTCAACGACCTGCAACTGCAACTGGCGGGCCTCGC
CCGTTCCAGCACGCCGGAGCAGGCCGCGTTCGAACTGGCCAAGACCCGCATGAGCGGCCAGCGTGATGCG
CTGACCAACCTGCGCAATGCATCGGGTCGTCTGCCGCGTCCGTTGAGCGTGTGGTTCAACGTGCTGGCTG
AGGACTCGTGGCGCCTGGTGCTCAACGATGCCTACCAGTACCTGAACGGCCGTTATCAGAACGAGCTGTA
CAGCGTGTATGGCAAGACGATCAACAAGCGTTACCCGTTCAGCGCCTCGAGCACCAGCGATGTGGCGATC
AGCGATTTCCGCGAGTTCTTCCGGGCTCAAGGCACCATCGACCGCTTCTTCGACAGCTACATGCGTCCGT
TCGTCAGCGGTGATCCGGGCAACTACCGGATGCGCAGCATCGACGGTCGCAGCCTGCCGGTGTCCAAGGT
CTTCCTCGACCAGATGGCGGCGGCCCTGAACATCCGTCAGAGCTTCTTCTCGATCAATCCGGCCGAGCCG
ACCGTGCAGTTCAAGCTGGAGCCGTACACCCTCGATCCGGCCGTCAGCCGTTCCGAGTTCAAGTTCGGTG
ACAAGACCATGGAATACCGCCACGGTCCGATCCTGCCCATGACCTTCAAGTGGCCGACCGATGCTGAAGA
CGGTCGCACCAGCCTGGTCATGGACAAGATGGCCGGGCGCCCGATCGGCATCGAGAAGAACTCCGGCCCG
TGGTCGCTGTTCCGTCTGTTCGACCTGATGCAGACGGAGTACCTGACCGGTCGCGACGTGCTGGTGCTGA
AAGCCGATGTGGGTGGCCTGCGCGCCAACTACCTGCTGACCAGCCAGCGCACGCCGAACCCGTTCGACAT
GGGCGTAATGCGTACCTTCCGTATGCCGGTGCAGCTCTGA
 Primer design