SecReT6
Protein ID: 77461804
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5583
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6254065..6255591 [-]
ProductFis family transcriptional regulator
NoteSfa2
UniProt IDQ3K4I4
KEGG IDpfo:Pfl01_5583
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 1.70E-70, Aligned region: 196..363
Sigma54_activ_2 [PF14532], Evalue: 3.90E-22, Aligned region: 197..367
HTH_8 [PF02954], Evalue: 4.10E-12, Aligned region: 353..360
HTH_8 [PF02954], Evalue: 4.10E-12, Aligned region: 459..498
AAA_5 [PF07728], Evalue: 4.10E-06, Aligned region: 220..338
HTH_30 [PF13556], Evalue: 4.60E-05, Aligned region: 14..26
HTH_30 [PF13556], Evalue: 4.60E-05, Aligned region: 468..500
Protein Sequence: 508 a.a.     [Download]
>gi|77461804|ref|YP_351311.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MFTQVPQPLLYAEALLAQFASLSRAADGAALLGDFVRGLAGLSGCELTQLYLLDATHTSLGMNAECLDGV
LQPRSAASLPADYNGEQLLQFALCQNRVVSFDDLGGSLHETSFLPASSTPWQSLLCVPLVNQQKAVEGLL
LCASRRHIDLQGFADSLGQLGSFVLGQLHLLQRLRQPVDAAAPVVRSLPSASGYGLIGKSAAMRQTYSLI
SKVLHSPYTVLLRGETGTGKEVVARAIHDCGPRRSQAFIVQNCAAFPENLLESELFGYRKGAFTGADRDR
AGLFDAANGGTLLLDEIGDMPLSLQAKLLRVLQEGEIRPLGSNDTHKIDVRIIAATHRDLSVLVSEGKFR
EDLYYRLAQFPIELPALRQREGDILDLAKHFADKACTFLQRDPVRWSDAALEHLSGYTFPGNVRELKGLV
ERAVLLCEGGELLAEHFSLRLESAPAPEDHCGLNLRERLEAVERNLLLDCLRKNDGNQTLAARELGLPRR
TLLYRLGRLNINLGDFDG
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6255591-6254065 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGTTCACTCAAGTGCCGCAGCCACTGCTCTATGCCGAAGCCTTGCTGGCGCAGTTCGCCAGCCTGTCGC
GCGCGGCGGACGGTGCTGCGCTGCTGGGTGACTTCGTGCGCGGTCTGGCCGGGCTGAGCGGTTGCGAACT
GACGCAGCTGTACTTGCTGGACGCCACGCACACGTCGCTGGGAATGAACGCCGAATGCCTCGACGGTGTG
CTGCAACCGCGCAGCGCGGCGAGCCTGCCGGCGGACTACAACGGCGAGCAACTGTTGCAGTTCGCCCTGT
GCCAGAACCGCGTGGTGAGCTTCGACGACCTGGGCGGCAGCCTGCACGAAACCAGTTTTCTGCCGGCGTC
GTCCACGCCGTGGCAGTCGCTGTTGTGCGTGCCGCTGGTCAATCAGCAGAAGGCCGTCGAAGGCCTTCTG
CTGTGCGCAAGCCGTCGCCACATCGACCTGCAAGGCTTCGCCGATTCCCTCGGCCAGCTCGGCTCGTTCG
TGCTTGGTCAGCTGCATCTGCTGCAGCGTCTGCGCCAGCCAGTGGATGCGGCCGCGCCGGTCGTGCGCAG
CCTGCCGAGTGCCAGTGGCTATGGCCTGATCGGCAAGAGCGCGGCGATGCGCCAGACCTACTCGCTGATC
AGCAAAGTCCTGCACAGCCCGTACACCGTGCTGTTGCGTGGCGAGACCGGCACCGGCAAGGAAGTGGTCG
CGCGGGCGATCCACGATTGCGGCCCGCGCCGGTCCCAGGCGTTCATCGTGCAGAACTGCGCGGCGTTCCC
GGAAAACCTGCTGGAAAGCGAGCTGTTCGGCTACCGCAAAGGTGCGTTCACCGGCGCCGATCGCGACCGC
GCCGGGCTGTTCGACGCGGCCAACGGCGGCACTCTGTTGCTCGATGAAATCGGCGACATGCCGCTGTCGC
TGCAAGCCAAATTGCTGCGTGTATTGCAGGAAGGCGAGATCCGTCCGCTGGGTTCCAACGACACCCACAA
GATCGACGTGCGAATTATCGCTGCGACGCACCGCGATCTGTCGGTGCTGGTCAGCGAAGGCAAATTCCGT
GAGGACCTGTACTACCGCCTCGCGCAATTTCCGATCGAGTTGCCGGCCCTGCGTCAGCGTGAAGGCGACA
TCCTCGACCTCGCCAAACACTTCGCCGACAAGGCCTGCACTTTCCTGCAACGTGATCCGGTGCGCTGGTC
GGACGCAGCGCTGGAACACCTGTCCGGTTACACCTTCCCCGGCAACGTGCGTGAACTCAAAGGTCTGGTC
GAACGCGCGGTGCTGTTGTGCGAGGGCGGCGAGTTGCTGGCCGAACATTTCTCGCTGCGCCTGGAATCGG
CGCCAGCGCCGGAAGACCACTGCGGCCTCAATCTGCGCGAACGACTGGAAGCGGTCGAACGCAATCTGTT
GCTCGATTGCCTGCGCAAGAACGACGGCAACCAGACGCTCGCCGCCCGGGAACTGGGCTTGCCGCGCCGC
ACGCTGCTGTACCGGCTCGGCCGCTTGAACATCAATCTGGGTGATTTCGATGGGTAG
 Primer design