SecReT6
Protein ID: 77465488
SecReT6 ID99
T6SS typei3
Gene symbol-
Locus tagRSP_3487
StrainRhodobacter sphaeroides 2.4.1
Repliconchromosome II [GenBank: NC_007494] [Browse all T6SS(s) in this replicon]
Location [Strand]558051..561572 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ3IWJ4
KEGG IDrsp:RSP_3487
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-87, Aligned region: 189..448
IcmF-related [PF06761], Evalue: 2.10E-67, Aligned region: 503..802
DUF1215 [PF06744], Evalue: 8.00E-32, Aligned region: 914..1032
AAA_16 [PF13191], Evalue: 0.00021, Aligned region: 127..259
Protein Sequence: 1173 a.a.     [Download]
>gi|77465488|ref|YP_354991.1| unnamed protein product [Rhodobacter sphaeroides 2.4.1]
MRALRLLLAALTSRTLWTFLGLALLCGLVWQFGALVSVGETVPLASDLARGLVVGCIAVGWLLSLLAAQL
RAARRNQLFVTELAAPAPAAPDPGAAAVAEVGARFRQVMAEMKRSRVGGRRFLRDMPWYLLIGPPGTGKT
TALRQSGLHFPIDPGDDLQGVGGTRNCDWFFTEQAVLVDTAGRYVQQQSDPEADAAEWSGFLDLLKRHRG
RRALNGVIVALSMTELLGPEPALRAHGREIRKRLSELGQRLQIRLPVYLMVTKADLVPGFETFFAPLPAR
GREQVWGATLAPDERPEGGAVDREARALWQELEARVGPRLAEEATLADRAEIFRFPARMAEVEAPLRVLI
ATLFGESRYEDSPWLRGFYFTSATQEGSPIDRMLGDLAGAFGLSAPAPPRRARGETRSYFLHDLLAKVIF
PEAGLGRLDRAAEERRRWLWRGSVAGAALATAVAGLGFLLSFLGWSGAIEDQARLTADLSARLANVAARQ
APTEPLDLPLALEAATAADAARTEPPSGPFALIGPSAAAEIERAGTIAYERTLANVLAPRMVALLEASMW
RQVRDPDDMLGALKAYFMLTGLAPYDRDFLTGWRQEQLPQQAVLDPFPTEAARWHQLAALSLFGTQGDPI
PPDEELVAAALASICTIPLAARAYGALMQDPAVTGLPDWIPGDRAGPNGARIFTRLSGKTLRVGLPGAFT
FAGFHETILPLVPEVAAQATLDRTLFAGGCGGSAGASAATLEADILKLYSDDFIARWDGLLRDIRLAPLT
DFATATAAMKDLASPDSALKRLLAAVVAETDLTRVPAPDAAPPEGLLKAAGKKLGKVGKLVKGAAALSAG
SAPPTEPPGQAVARHFEPLKGMIAEVEGVPPRIGDAELALGALANALQTAAANPDPQAALTAQGGLATLT
GGLTEVAARLPPPIGAWLEGLATDTASVTREAAIARLNARYRADILPFCRAATAGRYPFEPGSAIDVNTA
DFQRLFGPGGLFDGFTGDALGPWIDTTRHPWAWRADLGLDARSLAPFEAARRMRDGLFAGGIGPVMGFLL
QATDLSPNAARVTLSLDGQQLVYMNAATPPVGMTWPGQNGTNLIVLSFTPLDGSAEAVTSESGAWAWLRL
IGKGSLAPTAQPDLFRLRLAAGAYAARFDLRANSVENPLDLRLFGGFRCPDGF
 
Nucleotide Sequence: 3522 bp     [Download]
>gi|77464988|ref|NC_007494.1|:558051-561572 Rhodobacter sphaeroides 2.4.1 chromosome 2, complete sequence
ATGCGCGCGCTCCGCCTCCTCCTCGCCGCCCTGACCTCGCGGACGCTCTGGACCTTCCTCGGGCTCGCGC
TCCTCTGCGGGCTGGTCTGGCAGTTCGGCGCGCTGGTCTCGGTGGGCGAGACGGTGCCGCTCGCCTCCGA
CCTCGCGCGCGGGCTGGTCGTGGGCTGCATCGCGGTGGGCTGGCTTCTGTCGCTGCTGGCAGCCCAGCTG
CGGGCGGCGCGCAGGAACCAGCTCTTCGTGACCGAGCTTGCGGCGCCCGCGCCCGCCGCCCCCGATCCCG
GCGCGGCGGCCGTGGCCGAGGTCGGGGCGCGGTTCCGGCAGGTGATGGCCGAGATGAAACGCTCGCGCGT
GGGCGGGCGGCGCTTTCTGCGCGACATGCCGTGGTATCTGCTGATCGGCCCGCCCGGCACCGGCAAGACC
ACGGCCCTGCGCCAGTCGGGGCTGCATTTCCCGATCGATCCCGGCGACGACCTGCAAGGCGTGGGCGGCA
CGCGGAACTGCGACTGGTTCTTCACCGAACAGGCCGTGCTGGTGGACACCGCCGGGCGCTACGTCCAGCA
GCAGAGCGATCCCGAGGCCGATGCGGCGGAATGGTCGGGTTTTCTGGACCTTCTGAAGCGCCACCGCGGG
CGGCGGGCGCTGAACGGCGTGATCGTGGCCCTGTCGATGACCGAGCTCCTTGGGCCCGAGCCTGCGCTGC
GCGCTCATGGCCGCGAGATCCGCAAGCGGCTGAGCGAGCTCGGCCAGAGGCTCCAGATCCGCCTGCCGGT
CTATCTGATGGTGACGAAGGCCGACCTCGTGCCGGGCTTCGAGACCTTCTTCGCGCCCCTGCCCGCGCGC
GGGCGCGAGCAGGTCTGGGGGGCGACGCTCGCGCCCGACGAACGTCCCGAGGGCGGGGCGGTCGACCGCG
AGGCCCGGGCGCTCTGGCAGGAACTCGAGGCCCGCGTCGGGCCGCGGCTGGCCGAGGAGGCCACGCTGGC
CGACCGGGCCGAGATCTTCCGCTTCCCCGCGCGGATGGCCGAAGTCGAGGCGCCGCTGCGGGTGCTGATC
GCCACCCTCTTCGGCGAGAGCCGCTACGAGGACAGCCCCTGGCTCCGCGGCTTCTACTTCACCTCGGCCA
CGCAGGAGGGCTCGCCCATCGACCGGATGCTCGGGGATCTGGCGGGCGCCTTCGGCCTCAGCGCGCCCGC
GCCTCCCCGCCGGGCGCGGGGCGAGACACGCTCCTATTTCCTGCACGATCTTCTGGCGAAGGTGATCTTC
CCGGAAGCCGGGCTCGGTCGCCTCGACCGGGCGGCGGAGGAGCGGCGCCGCTGGCTCTGGCGCGGCTCGG
TGGCGGGCGCGGCGCTCGCCACGGCGGTGGCGGGGCTGGGGTTCCTTCTCTCGTTCCTCGGCTGGTCGGG
CGCCATCGAGGATCAGGCGCGGCTGACCGCGGATCTCTCCGCCCGGCTGGCCAATGTGGCCGCGCGGCAG
GCGCCGACCGAGCCGCTGGACCTTCCCCTCGCGCTGGAAGCCGCGACTGCCGCGGACGCCGCGCGCACGG
AGCCGCCCTCGGGCCCCTTCGCCCTCATCGGCCCCTCGGCTGCGGCCGAGATCGAGCGGGCGGGCACCAT
CGCCTACGAGCGCACGCTGGCCAATGTGCTTGCGCCGCGGATGGTGGCGCTGCTCGAGGCCTCGATGTGG
CGGCAGGTGCGCGATCCCGACGACATGCTGGGCGCGCTCAAGGCCTATTTCATGCTCACCGGCCTCGCGC
CCTACGACCGCGACTTCCTGACCGGCTGGCGGCAGGAGCAGCTGCCGCAGCAGGCGGTGCTCGACCCGTT
CCCGACCGAGGCGGCCCGCTGGCACCAGCTGGCCGCGCTTTCCCTTTTCGGCACGCAGGGCGACCCCATC
CCGCCCGACGAGGAGCTGGTGGCGGCGGCGCTGGCCAGCATCTGCACCATCCCCCTCGCGGCCCGCGCCT
ATGGCGCGCTGATGCAGGATCCCGCGGTCACGGGCCTGCCCGACTGGATCCCGGGCGACCGCGCCGGGCC
GAACGGCGCGAGGATCTTCACCCGCCTCTCTGGCAAGACGCTGCGGGTGGGGCTGCCCGGCGCCTTCACC
TTTGCGGGCTTTCACGAGACGATCCTGCCGCTCGTGCCCGAGGTGGCCGCGCAGGCCACGCTCGACCGGA
CCCTCTTTGCGGGCGGCTGCGGCGGCAGCGCCGGGGCCTCGGCCGCCACGCTCGAGGCGGACATCCTGAA
GCTCTATTCCGACGATTTCATCGCGCGCTGGGATGGGCTTCTGCGCGACATCCGGCTGGCGCCGCTGACG
GACTTCGCCACCGCCACTGCGGCGATGAAGGATCTGGCGAGCCCCGACAGTGCGCTGAAGCGGCTGCTCG
CTGCGGTCGTGGCCGAGACCGACCTCACGCGCGTTCCCGCCCCAGATGCGGCGCCGCCCGAGGGTCTCCT
CAAGGCCGCCGGCAAGAAGCTCGGGAAGGTGGGCAAGCTCGTGAAGGGGGCCGCGGCGCTGTCGGCGGGC
TCCGCTCCGCCCACGGAGCCGCCGGGGCAGGCGGTGGCGCGCCATTTCGAGCCGCTGAAGGGGATGATCG
CCGAGGTGGAGGGGGTGCCGCCGCGGATCGGGGATGCCGAACTCGCGCTCGGCGCGCTGGCCAATGCGCT
TCAGACCGCGGCGGCCAATCCCGATCCGCAGGCGGCGCTGACCGCGCAGGGGGGGCTTGCCACGCTGACC
GGCGGGCTGACCGAGGTCGCCGCCCGCCTGCCGCCCCCCATCGGCGCCTGGCTCGAGGGGCTGGCCACGG
ACACGGCCAGCGTGACGCGCGAGGCGGCGATCGCTCGGCTGAACGCGCGCTACCGGGCCGACATCCTGCC
CTTCTGCCGCGCCGCCACCGCGGGCCGTTATCCGTTCGAGCCGGGCTCGGCCATCGATGTGAACACAGCC
GATTTCCAGCGCCTCTTCGGGCCCGGCGGCCTCTTCGACGGCTTCACGGGCGACGCGCTCGGGCCCTGGA
TCGATACGACGCGGCACCCTTGGGCCTGGCGCGCCGATCTGGGGCTCGATGCCCGGAGCCTCGCGCCCTT
CGAGGCCGCCCGGCGGATGCGCGACGGTCTCTTCGCCGGAGGCATCGGCCCGGTGATGGGCTTCCTGCTT
CAGGCGACGGACCTGTCGCCCAATGCCGCCCGGGTGACGCTGAGCCTCGACGGCCAGCAGCTTGTCTACA
TGAATGCGGCCACGCCCCCCGTGGGCATGACCTGGCCCGGCCAGAACGGAACGAACCTCATCGTGCTCTC
CTTCACGCCGCTCGACGGGTCGGCCGAGGCGGTGACCTCGGAATCCGGCGCCTGGGCCTGGCTCCGGCTG
ATCGGCAAGGGCAGCCTCGCGCCCACCGCGCAGCCCGACCTGTTCCGGCTGCGCCTTGCCGCCGGAGCCT
ATGCCGCGCGCTTCGATCTCCGGGCGAATTCGGTGGAGAACCCGCTCGACCTCAGGCTCTTCGGCGGGTT
CCGCTGCCCGGATGGCTTCTGA
 Primer design