SecReT6
Protein ID: 77465491
SecReT6 ID99
T6SS typei3
Gene symbol-
Locus tagRSP_3490
StrainRhodobacter sphaeroides 2.4.1
Repliconchromosome II [GenBank: NC_007494] [Browse all T6SS(s) in this replicon]
Location [Strand]564383..566791 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ3IWJ1
KEGG IDrsp:RSP_3490
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 9.30E-42, Aligned region: 198..483
DUF1215 [PF06744], Evalue: 1.60E-25, Aligned region: 554..671
Protein Sequence: 802 a.a.     [Download]
>gi|77465491|ref|YP_354994.1| unnamed protein product [Rhodobacter sphaeroides 2.4.1]
MPQDLARGPASDPFARAAAPALAFAEELGRRRDPPAALAAEARAHLDRFGRALAGEVPAAAVPPARYALA
LVIDRQARANPSLDLRLWEAAARAQLFDGRALGEPDLRRFLRSAAEAGPAFAPVQPFLQACLDRLEARRT
RLQPTAVESWRGIAAVLAASFGFAVAGWALHVEWSFHHRLAEAFEARAAEAAALPLRARLDTLADAASGV
ATEVQQAPVALAAGPLGFDAAAGAEAAYRAEVQAALPAVLVQAVEEAIASEADPAASYDTVRAWAILSGA
ADWSPAWLAGWLDRRAAPAEMRGLARHVRQLAPPEGPLPQPDADLLAQARAFAAEASEADRAWLELLRSE
GAAALPPWQAEAAVPGLAAVVIRRSGAALDAPVPGLFTAAGWTYARDRGAGLAVQAARREARLLDRPTAE
SNASADRVLELLQAETLARWQALLADLRVVPFRTADTAVRVSGALARPESPLTQLLREVWHQVGGEDPLR
PHALQLKIAAVFGPTRQFVDQGGMTRIAALFAALNAALGGLDRDSPTGLQRLMQAEDRARSIATLRQAPA
LVVEIIEDLLAQAGSAQAAGLTNPLTAAWQAEVLPLCRATLDGRYPFAEGADADPAGVERLLGRNGALAA
FVAARAAPYLDRSASPWRWKPEARFAGLSPDSAAFLERASAAGPGLTGPRTLTLTALAERGTAAVMLGGQ
GGPVTTTSDSLRLDWPGLQPDRGAEIAFRTPEGAARLAAPGPWGLLRLLEPFRLRPREGGLRFLIDLRSG
GARLFLEAAFDAAPNPLSVRRLVRGLACPQVL
 
Nucleotide Sequence: 2409 bp     [Download]
>gi|77464988|ref|NC_007494.1|:c566791-564383 Rhodobacter sphaeroides 2.4.1 chromosome 2, complete sequence
ATGCCGCAGGATCTCGCCCGAGGCCCCGCCTCCGATCCGTTCGCCCGCGCCGCGGCCCCCGCGCTGGCCT
TCGCCGAGGAGCTGGGCCGGAGGCGTGATCCTCCCGCAGCGCTGGCGGCCGAGGCCCGGGCGCATCTCGA
CCGGTTCGGGCGCGCGCTTGCAGGTGAGGTTCCCGCGGCCGCGGTGCCGCCCGCGCGCTATGCGCTGGCG
CTGGTGATCGACCGGCAGGCGCGCGCGAACCCGAGCCTCGACCTGCGTCTGTGGGAAGCGGCCGCGCGGG
CGCAGCTCTTCGACGGTCGCGCTCTGGGCGAGCCGGACCTGCGCCGCTTCCTCCGCAGCGCCGCCGAGGC
CGGGCCCGCCTTCGCGCCGGTGCAGCCGTTCCTGCAGGCCTGCCTTGACCGGCTGGAGGCCCGGCGGACA
CGCCTCCAGCCGACCGCCGTGGAAAGCTGGCGCGGGATCGCGGCGGTTCTGGCCGCCTCCTTCGGGTTCG
CGGTGGCGGGCTGGGCGCTGCATGTCGAATGGAGCTTCCATCACAGGCTGGCCGAGGCCTTCGAGGCCCG
TGCTGCGGAGGCGGCGGCCCTGCCGCTCCGCGCGCGGCTCGACACGCTCGCGGATGCGGCGTCCGGTGTC
GCGACCGAGGTGCAGCAGGCGCCGGTCGCGCTGGCCGCGGGGCCTCTCGGCTTCGACGCGGCGGCCGGTG
CCGAGGCAGCCTACCGCGCGGAAGTGCAAGCCGCGCTGCCGGCGGTTCTGGTGCAGGCCGTCGAGGAGGC
CATCGCCTCGGAGGCCGATCCGGCGGCGAGCTATGACACGGTGCGGGCCTGGGCGATCCTGAGCGGCGCG
GCTGACTGGTCGCCTGCCTGGCTGGCAGGCTGGCTCGACCGTCGCGCGGCTCCGGCGGAGATGCGGGGCC
TCGCGCGGCATGTGCGGCAGCTGGCGCCGCCCGAGGGACCCCTGCCGCAGCCGGATGCCGATCTTCTGGC
GCAGGCCCGCGCCTTTGCCGCCGAAGCGTCCGAGGCCGACCGCGCCTGGCTCGAACTCCTGCGCTCGGAA
GGCGCGGCGGCGCTTCCGCCGTGGCAAGCGGAGGCGGCGGTGCCGGGGCTCGCAGCCGTGGTGATCCGTC
GGTCGGGGGCCGCGCTCGACGCGCCGGTCCCCGGCCTCTTCACGGCGGCGGGCTGGACCTACGCCCGCGA
CCGCGGCGCCGGGCTGGCGGTGCAGGCGGCGCGGCGCGAGGCGCGGCTGCTCGACCGGCCGACCGCCGAG
AGCAACGCCAGCGCCGACCGCGTACTGGAGCTTCTGCAGGCCGAGACGCTCGCCCGGTGGCAGGCCCTGC
TCGCCGATCTGCGCGTGGTGCCCTTCCGGACCGCCGACACGGCCGTGCGGGTCTCGGGCGCGCTGGCGCG
ACCCGAGTCGCCGCTCACGCAGCTTCTGCGCGAGGTCTGGCATCAGGTGGGCGGCGAGGATCCGCTGAGG
CCCCATGCGCTGCAGCTGAAGATCGCGGCCGTCTTCGGGCCGACGCGTCAGTTCGTGGATCAGGGCGGCA
TGACACGGATCGCCGCGCTCTTTGCGGCGCTGAATGCGGCTCTGGGGGGCCTCGACCGCGACAGTCCGAC
GGGTCTCCAGCGGCTGATGCAGGCCGAGGACCGGGCGCGCAGCATCGCCACGCTGCGGCAGGCGCCCGCG
CTGGTGGTCGAGATCATCGAGGATCTGCTGGCGCAGGCGGGCTCGGCGCAGGCCGCGGGTCTCACGAACC
CGCTGACGGCGGCGTGGCAGGCCGAAGTGCTGCCGCTCTGTCGCGCGACGCTCGACGGGCGCTATCCGTT
CGCCGAGGGGGCCGACGCCGACCCCGCCGGGGTGGAGCGGCTTCTGGGCCGGAACGGGGCGCTCGCGGCC
TTCGTGGCGGCGCGCGCCGCGCCCTATCTCGACCGGAGCGCCAGCCCCTGGCGCTGGAAGCCCGAGGCGC
GCTTCGCCGGGCTTTCGCCCGACAGCGCGGCCTTCCTCGAACGGGCGAGCGCCGCAGGTCCCGGCCTGAC
CGGGCCGAGGACGCTCACGCTCACCGCTCTGGCCGAGCGGGGCACGGCCGCGGTGATGCTGGGCGGGCAG
GGTGGCCCCGTCACCACCACGAGCGACAGCCTGCGGCTCGACTGGCCCGGCCTGCAGCCCGACCGCGGCG
CCGAGATCGCTTTCCGCACGCCCGAGGGCGCGGCGCGGCTGGCGGCGCCGGGGCCCTGGGGCCTCCTCCG
GCTCCTCGAGCCCTTCCGGTTGCGGCCCCGCGAGGGCGGGTTGCGGTTCCTCATCGACCTGCGCTCCGGC
GGTGCGCGGCTCTTTCTCGAAGCCGCCTTCGACGCGGCGCCGAACCCGCTCTCGGTGCGACGACTCGTGC
GCGGGCTCGCCTGTCCGCAGGTCCTGTGA
 Primer design