SecReT6
Protein ID: 77920401
SecReT6 ID100
T6SS typei2
Gene symbol-
Locus tagPcar_2811
StrainPelobacter carbinolicus DSM 2380
Repliconchromosome [GenBank: NC_007498] [Browse all T6SS(s) in this replicon]
Location [Strand]3277808..3281395 [+]
Producthypothetical protein
NoteTssM
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.40E-78, Aligned region: 74..125
ImcF-related_N [PF14331], Evalue: 2.40E-78, Aligned region: 186..446
IcmF-related [PF06761], Evalue: 4.00E-66, Aligned region: 492..825
DUF1215 [PF06744], Evalue: 5.20E-30, Aligned region: 933..1051
Protein Sequence: 1195 a.a.     [Download]
>gi|77920401|ref|YP_358216.1| hypothetical protein Pcar_2811 [Pelobacter carbinolicus DSM 2380]
MQNILIFLQAYLFGRLGSRILGLMLILSLIWWAGPYVGIDDTSLRIYLILGTLTLFFGIWLVRKSIAKRR
GNQFRQDLDSQTGQDQSRQLEIEELKAKMNQAVASLKSSELGSHRRGNAALYALPWFMIIGPSAAGKTTL
LRNSGLHFPYANGEDIDIRGFGGTRNCDWWFSNEAVLLDTAGRYTTEQDDHEEWLAFLSMLRKHRRQQPL
TGAIVAISLSDLLTADTQELERHVKIIRDRINELTTKLGCIFPIYIVFTKCDLLYGFSSYFADLTPKERE
QVWGSWLGHEKDSNICQAFIRRMETLHHRLCELRLQKLSMVRNMRAKSELFDFPSQFEAAKDRLVAFISR
LTEANPYQDTPHFCGIYLTSATQEGTPLQKILGNIRQAFGYVDEDQSSEQAETKSFFVKDFFKEVVFPNA
NDVSRTKKQGILHRALKTACIITSLAVITGCFLLLSTTLTMNTLLLKKGTDTSEHLAQEAQTKNNGVNQD
FKALTQVLAHYRTLMNYEKHLPLSYTLGIYEGDKQLPAIRSILLNAFKRIFFKPAIKDLEMRLVNYSQVW
AAADLQRQDQIRDPYYKTLKCYLMLSTPKRLEAEFAAPVLQTLIQERLMGFAKGQSLDKDSQRQLSELIH
LYLSHMQIDQNHPDYMETVKLEASLVTDAQNHLKAIPDAGRLYTQILNKGKLIAPALHLKDMIKGPGRSV
LASSFTMPFMFTSKGWHNYVQPEIDNLVHIACQGDWVTGYLPDSLSDASGTKTDTSANNPLAVQLETEIR
ALYFADYVDHWFSLLAEIQLPPFHSLDDAAKKMLLLARNDGPIAELLQVVSRNINIGQAKGSLASDGSVQ
SASLVQELENPLHDLRKLTDPGDKMNTSLLINQYLLALTAAQAEIEQMAAAVDVPQQSFQYASTILGSNG
VTSSELYKCWLSTNSLLNGTDVRTRKVAEHLLYKPIAGAWKAIIQQTQSYVQNQWSSTVFLNYQGKIAGK
FPFSNNGADASLNDVADFFRPEDGLIWAFTDDQLKPFLRKERNRWTEKTWLGTGLAFDKSLLRSLGLASR
ITSGMFRRGQIQPDVHFSIYPIPSQGLRVVRFETNGQQMIYQNEPQEWKRFQWPGDEDQNSAFIGCIPSG
NQSMVKIKFSGDWSLFHLLNKAKITQNHNLYTLDWKLKTGQNNDAIVHLKLRPDRHSNVFAQGLFSQFRL
PSNIF
 
Nucleotide Sequence: 3588 bp     [Download]
>gi|90960985|ref|NC_007498.2|:3277808-3281395 Pelobacter carbinolicus DSM 2380 chromosome, complete genome
ATGCAAAATATTCTGATTTTCCTTCAGGCTTATCTTTTCGGGCGGCTAGGCTCCCGAATCCTTGGGCTGA
TGCTAATCCTGTCACTGATCTGGTGGGCCGGCCCCTACGTAGGCATCGATGATACCTCGTTGCGTATTTA
TCTCATCCTTGGAACCTTAACTCTGTTTTTCGGCATCTGGTTGGTACGCAAAAGCATCGCTAAACGGCGT
GGCAATCAATTCAGACAAGACCTCGACTCTCAGACAGGCCAGGACCAATCACGCCAATTGGAAATTGAAG
AGCTCAAGGCCAAGATGAACCAGGCCGTCGCCTCGTTAAAATCTTCCGAACTTGGAAGTCACCGTCGTGG
CAATGCCGCCTTGTACGCCCTGCCCTGGTTCATGATCATTGGCCCTTCGGCAGCCGGGAAAACCACCTTA
CTGCGCAACTCCGGGCTGCATTTCCCCTATGCCAACGGCGAAGACATCGACATACGAGGCTTTGGTGGCA
CTCGCAATTGCGACTGGTGGTTTTCCAACGAAGCGGTTTTGCTCGATACAGCCGGACGCTATACCACGGA
GCAGGACGACCACGAAGAATGGTTGGCCTTTTTAAGTATGCTGCGCAAGCATCGCCGCCAGCAACCTCTG
ACTGGCGCTATTGTCGCCATCAGCCTATCGGACCTGCTAACAGCCGATACCCAGGAACTGGAGCGTCATG
TCAAAATCATTCGTGATCGCATCAATGAATTAACCACTAAACTCGGATGTATTTTCCCTATTTATATCGT
TTTCACCAAATGTGATCTTCTCTACGGTTTTTCTTCCTATTTTGCGGATCTGACTCCCAAGGAGAGGGAA
CAAGTCTGGGGCAGTTGGCTGGGGCACGAAAAGGATAGCAACATCTGCCAGGCCTTTATCCGCAGAATGG
AAACTCTACACCATCGCCTATGCGAGTTGCGGTTGCAGAAACTCTCCATGGTCCGGAACATGCGCGCCAA
AAGCGAACTTTTTGATTTCCCCTCCCAGTTCGAGGCTGCTAAAGATCGTCTTGTCGCATTCATTTCGCGA
CTAACTGAAGCAAACCCCTACCAGGACACCCCTCACTTTTGCGGCATCTATCTGACCAGCGCCACCCAGG
AAGGTACCCCCCTGCAGAAAATCCTTGGCAATATACGCCAGGCCTTTGGTTATGTGGATGAAGACCAATC
CTCAGAACAGGCAGAAACTAAAAGCTTTTTTGTAAAGGATTTTTTCAAAGAGGTTGTTTTTCCCAATGCC
AATGATGTCAGTCGAACAAAAAAGCAGGGCATACTGCACCGCGCTCTGAAAACCGCCTGCATCATAACAT
CCCTGGCTGTCATCACAGGCTGTTTCCTGCTACTCAGCACGACTCTGACCATGAATACCTTGCTGCTTAA
AAAAGGAACCGACACCTCGGAGCATCTGGCGCAGGAAGCGCAAACGAAAAACAACGGCGTGAATCAGGAC
TTTAAGGCATTGACACAGGTTCTGGCACACTACCGCACCCTTATGAATTACGAAAAACACCTGCCGCTGT
CTTATACCTTAGGAATCTACGAGGGGGACAAACAATTGCCGGCGATCCGCTCTATTCTGCTTAACGCTTT
TAAACGGATCTTTTTCAAACCGGCAATCAAAGATCTGGAGATGCGTCTGGTCAACTATTCCCAGGTATGG
GCGGCGGCCGACCTGCAACGCCAGGATCAAATCCGCGACCCCTATTACAAAACGCTAAAATGCTACCTGA
TGCTCAGTACACCCAAACGGCTGGAGGCCGAGTTTGCCGCGCCAGTACTGCAGACCCTTATCCAGGAACG
TTTGATGGGATTTGCCAAAGGGCAGTCTCTGGATAAGGACTCGCAACGACAGCTGTCCGAATTGATCCAT
CTCTATTTATCCCACATGCAGATTGACCAAAACCACCCCGATTATATGGAGACTGTTAAACTCGAAGCAT
CTCTGGTAACCGACGCGCAAAACCACCTCAAAGCCATACCGGATGCCGGCCGCCTTTACACACAAATCCT
CAATAAGGGCAAATTAATAGCCCCTGCCCTCCACCTCAAGGACATGATCAAAGGGCCAGGACGAAGTGTT
CTGGCCAGCTCCTTCACCATGCCTTTCATGTTTACCAGCAAAGGTTGGCACAATTATGTGCAGCCTGAAA
TCGACAACTTGGTCCATATCGCCTGTCAGGGAGATTGGGTCACCGGTTATCTCCCGGATAGTCTGTCCGA
TGCCAGCGGTACGAAAACCGACACCTCGGCAAATAATCCATTGGCGGTTCAACTCGAAACCGAGATCCGC
GCCTTGTACTTTGCGGACTACGTTGACCATTGGTTCAGTCTGCTGGCTGAAATTCAATTGCCACCATTTC
ACTCCTTGGATGACGCTGCAAAGAAAATGCTGCTGCTGGCCCGCAATGACGGCCCCATCGCTGAACTGCT
GCAAGTCGTCTCCAGAAATATCAACATTGGCCAAGCAAAAGGGAGCTTGGCAAGCGACGGCTCAGTGCAA
AGTGCCTCGCTGGTCCAGGAACTGGAAAATCCTCTTCATGACCTGCGGAAACTGACCGATCCCGGCGACA
AGATGAATACCAGCCTGCTCATCAACCAGTACCTGCTGGCCTTAACAGCGGCCCAGGCAGAAATCGAACA
AATGGCGGCAGCCGTGGATGTGCCCCAGCAGTCATTTCAATACGCGTCGACCATCCTGGGCAGCAACGGC
GTCACCAGTTCCGAGCTGTACAAATGCTGGCTATCCACCAACAGTCTGCTCAACGGTACCGACGTCCGCA
CCCGCAAGGTAGCTGAGCATTTGCTGTACAAACCGATCGCTGGAGCCTGGAAAGCCATCATTCAGCAGAC
ACAGTCTTATGTACAAAACCAATGGAGCAGCACGGTTTTCCTGAATTACCAAGGGAAAATAGCCGGTAAA
TTCCCCTTTAGTAACAACGGTGCAGATGCCTCGCTTAATGATGTAGCGGACTTTTTCCGTCCCGAAGATG
GTCTGATCTGGGCTTTTACAGACGATCAACTCAAACCCTTTCTGCGTAAAGAGCGTAATCGGTGGACCGA
AAAAACCTGGCTTGGTACCGGTCTCGCTTTTGACAAAAGCCTGTTACGTTCTTTGGGACTGGCCTCGCGC
ATTACCTCTGGGATGTTTCGTCGCGGTCAGATTCAACCCGATGTTCACTTTTCCATCTATCCGATCCCCA
GCCAGGGACTACGAGTCGTACGCTTCGAAACCAACGGTCAACAAATGATTTATCAGAACGAACCGCAGGA
ATGGAAAAGGTTCCAATGGCCGGGAGATGAAGACCAGAACAGCGCGTTCATCGGCTGCATCCCAAGCGGC
AATCAATCCATGGTCAAAATCAAATTCTCCGGCGACTGGAGTCTTTTTCACCTGCTAAACAAAGCCAAAA
TTACGCAAAACCATAACCTGTACACCTTGGACTGGAAGCTGAAAACTGGCCAGAATAACGACGCCATAGT
ACACCTTAAACTTCGTCCCGATCGCCACAGCAATGTGTTTGCCCAAGGACTGTTCTCGCAGTTTCGACTG
CCGAGCAACATTTTTTAA
 Primer design