SecReT6
Protein ID: 78047694
SecReT6 ID101
T6SS typei3
Gene symbol-
Locus tagXCV2138
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]2451122..2454580 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ3BTP4
KEGG IDxcv:XCV2138
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-88, Aligned region: 197..459
IcmF-related [PF06761], Evalue: 1.70E-67, Aligned region: 511..809
DUF1215 [PF06744], Evalue: 4.90E-28, Aligned region: 762..783
DUF1215 [PF06744], Evalue: 4.90E-28, Aligned region: 896..1017
AAA_16 [PF13191], Evalue: 0.00097, Aligned region: 115..266
AAA_16 [PF13191], Evalue: 0.00097, Aligned region: 279..354
AAA_16 [PF13191], Evalue: 0.00097, Aligned region: 544..585
AAA_16 [PF13191], Evalue: 0.00097, Aligned region: 854..854
AAA_16 [PF13191], Evalue: 0.00097, Aligned region: 941..947
Protein Sequence: 1152 a.a.     [Download]
>gi|78047694|ref|YP_363869.1| hypothetical protein XCV2138 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MRLVLDFLRTRYVASAAVLALLAMLVWVGGPYLSVGRLQPLASVSGRLLAVAVLLLVWAGWRYLRWRRDN
AKQQRMAGELVGQGASAEDASGNDSRARAAQEQVRLRARFAEAMAVLRRRRRNGPGLHVLPWYLLIGAPG
SGKSTLLQSSGLEFPLKEHGNHAALEGVGGTRNCDWWFADQAVFLDSAGRYTTQDSDAIADAGAWHGFLD
LLRRHRRQPLNGVIVTVSVAELLELDGDAGLSHARAVRHRLDELVDKLRARVPVYLVVTKCDLVSGFAEF
FADLDAAGRAQVWGVSFPQAQAADDTDPLTPFPTELERLLERIDQRVLERLHRARDARERAAVLSFPQQL
RLLQPALMEFVQTAFGRHGYAGQPWLRGVYLSSGTQQGHPIDRVISAVARHFGVAAAGLPPAISAPRSYF
LPRLLNDVVFAEAGLAGSQPGSAQRRRLLQLACWAVLTATTLGVLSGMAGSYARNVQLIGQVRDALDAYP
AGALPADAGEAAFYAKALQRFDALARARDVALPPGQSIPWSRRFGLHQGRALARDVQDAYLRDLNGALLP
ALAQSLRRKLEQASNDPQRLYPLLKGYLMLGDPARRDVLHLATLAGTVWRQIFPDDASVRAGLNRHLRAL
LGPVDGARALALDRQQIEQTRASLRTAELPALVYGGLKLTQPGVDAGQAPRLDRRLGLLGDVFERRSGLP
LSAPLPPLFTRQAFQAQTGGGIARGVQQFLADDWVLGTAPLDPLARSQLERQVLALYQRDYIAAWDSLLA
DLVLRPVTQTGQASAVAAKLGGPASPLKALLVLLREHTHALGRTPPAKGGASAAAGGEATAAAEPDVAAD
PIERHFEPLNRLLDGGPGASALDETLAALTQMSRTLLGAAAGVAADQNDPALLIAAQQAEQLPPPLGNWM
ATLSGRGRALTASSAGEALRNAQRQAAGRECALLVSGRFPFVPGSRNDIPLRDFAELFGPGGRMDRFAQQ
SLLGKVDTSGRRWQWNPGMAAVGADDVLERAQLADEIKQAFFAGGGAQPQVAFTVSIPPQAAISRLQLEV
DGQTLEVREGARASQSMTWPGPNPGLVRVAAWDASGQALPVLEYRGPWAWFRALQAGRLRRSGDLDYTAS
LALGSATVRMDVQPASLRHPFAASAVQRFSCP
 
Nucleotide Sequence: 3459 bp     [Download]
>gi|78045556|ref|NC_007508.1|:2451122-2454580 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGCGCCTTGTGCTTGATTTCCTGCGCACCCGCTACGTCGCCAGTGCTGCCGTCCTCGCTTTATTGGCCA
TGCTCGTCTGGGTCGGCGGACCCTATCTCAGCGTGGGCCGGCTGCAGCCGCTGGCCAGCGTGAGCGGCCG
CCTGCTGGCCGTGGCCGTGCTGCTGCTGGTGTGGGCGGGGTGGCGCTACCTGCGTTGGCGCCGCGACAAC
GCCAAGCAGCAGCGCATGGCCGGCGAACTGGTCGGGCAGGGCGCCAGCGCCGAGGACGCCAGCGGCAACG
ACAGCCGCGCACGTGCAGCGCAGGAACAGGTCCGCCTGCGTGCGCGTTTTGCCGAGGCGATGGCGGTGCT
GCGGCGGCGCCGTCGCAACGGTCCCGGCCTGCATGTGCTGCCCTGGTATCTGCTGATCGGCGCGCCCGGT
TCCGGCAAGAGCACCTTGCTGCAGTCTTCGGGCCTGGAGTTTCCACTCAAGGAACATGGCAACCACGCCG
CGCTGGAAGGCGTTGGCGGTACGCGCAACTGCGATTGGTGGTTCGCCGACCAGGCAGTGTTCCTCGACAG
CGCCGGGCGCTATACCACCCAGGATTCGGACGCCATCGCCGATGCCGGTGCCTGGCACGGCTTTCTGGAC
CTGCTGCGGCGGCACCGCCGGCAGCCATTGAATGGCGTCATCGTGACGGTGAGCGTGGCCGAGCTGCTGG
AGCTCGATGGCGATGCCGGTCTGTCGCATGCGCGCGCGGTGCGTCATCGGCTGGACGAACTGGTCGACAA
ACTGCGCGCCCGCGTGCCGGTCTACCTGGTCGTGACCAAATGCGATCTGGTGTCGGGCTTTGCCGAGTTT
TTTGCCGATCTGGATGCCGCCGGCCGCGCGCAGGTGTGGGGAGTGTCGTTCCCACAGGCGCAGGCTGCCG
ATGACACCGATCCGTTGACGCCGTTCCCCACCGAGCTCGAACGCCTGCTGGAGCGGATCGATCAGCGCGT
GCTGGAGCGCCTGCATCGGGCGCGCGATGCACGCGAGCGTGCCGCGGTGCTGTCCTTTCCACAGCAGTTG
CGGCTGCTGCAACCGGCGCTGATGGAGTTCGTGCAGACCGCGTTCGGCCGCCATGGCTATGCCGGCCAGC
CGTGGCTGCGTGGTGTCTATCTGAGTTCGGGGACGCAGCAAGGCCATCCGATCGACCGCGTCATCTCGGC
AGTGGCGCGACACTTCGGCGTCGCCGCTGCCGGCCTGCCGCCGGCCATCAGCGCGCCACGCAGTTACTTC
CTGCCACGCCTGCTCAACGACGTCGTCTTCGCCGAGGCGGGCCTGGCCGGCAGTCAACCCGGCAGCGCGC
AGCGCCGTCGGTTGCTGCAGCTGGCCTGCTGGGCCGTGCTGACCGCCACCACCCTGGGCGTGCTGTCGGG
CATGGCCGGCAGTTACGCCCGCAACGTGCAACTGATCGGGCAGGTGCGCGATGCGCTCGACGCCTATCCT
GCCGGCGCGCTGCCTGCCGATGCCGGCGAGGCCGCGTTCTATGCCAAGGCCTTGCAGCGTTTCGACGCGC
TGGCGCGCGCGCGCGATGTGGCACTGCCGCCGGGTCAGTCGATCCCGTGGTCGCGACGCTTCGGTCTGCA
CCAGGGCAGGGCCTTGGCGCGCGATGTGCAGGACGCCTATCTGCGCGACCTCAACGGCGCGCTGCTGCCG
GCATTGGCGCAATCGCTGCGACGCAAGCTGGAGCAGGCCAGCAACGATCCGCAACGGTTGTATCCGCTGC
TGAAGGGCTACCTGATGCTGGGCGACCCGGCGCGCCGCGACGTCCTGCATCTGGCCACGCTGGCAGGCAC
GGTCTGGCGGCAGATATTTCCCGACGATGCGTCGGTGCGTGCGGGATTGAACCGGCATCTGCGCGCCCTG
CTGGGTCCGGTGGACGGTGCCCGCGCGCTCGCGCTGGATCGGCAGCAGATCGAGCAGACACGGGCGAGCC
TGCGAACCGCCGAACTGCCGGCATTGGTCTACGGTGGCCTCAAGCTGACGCAACCCGGCGTCGATGCCGG
CCAGGCGCCACGTCTGGATCGCCGCCTGGGCCTGTTGGGCGATGTCTTCGAACGCCGCAGTGGCCTGCCG
TTGTCTGCGCCATTGCCGCCGCTGTTTACCCGCCAGGCGTTCCAGGCACAGACCGGTGGCGGCATCGCGC
GTGGTGTGCAGCAGTTCCTCGCCGACGATTGGGTACTGGGCACGGCACCGCTGGACCCGCTGGCGCGTTC
GCAGCTGGAGCGCCAGGTATTGGCGCTGTATCAGCGCGATTACATCGCTGCCTGGGACAGCCTGCTGGCC
GACCTGGTGCTGCGGCCGGTCACCCAGACCGGGCAGGCGAGTGCGGTGGCCGCCAAGCTGGGCGGGCCGG
CATCGCCGTTGAAGGCCTTGCTGGTGCTGCTGCGCGAACACACCCACGCACTGGGGCGCACGCCACCGGC
CAAGGGCGGTGCGAGTGCTGCAGCGGGTGGAGAGGCCACCGCCGCGGCCGAGCCCGATGTGGCGGCCGAC
CCGATCGAACGCCATTTCGAGCCGCTCAACCGCTTGCTCGATGGCGGGCCGGGCGCCAGCGCGCTGGACG
AAACCCTGGCCGCGCTGACCCAGATGAGCCGTACGCTGTTGGGCGCTGCTGCCGGCGTTGCCGCCGACCA
GAACGATCCGGCGTTGCTGATCGCCGCGCAACAGGCCGAACAATTGCCGCCGCCGCTGGGAAACTGGATG
GCGACCCTATCCGGCCGCGGCCGCGCATTGACTGCCAGCAGCGCCGGCGAGGCGCTACGCAACGCGCAGC
GGCAGGCGGCCGGGCGCGAGTGCGCGCTGCTGGTGAGCGGGCGTTTCCCGTTCGTGCCGGGCAGCCGCAA
CGACATCCCGTTGCGCGATTTCGCCGAACTGTTCGGACCCGGCGGGCGCATGGACCGCTTTGCGCAGCAA
TCCTTGCTCGGCAAGGTCGATACCAGCGGGCGTCGCTGGCAGTGGAATCCGGGCATGGCGGCGGTCGGTG
CCGACGACGTGCTGGAGCGCGCGCAACTGGCCGACGAGATCAAGCAAGCGTTCTTCGCGGGCGGCGGCGC
GCAGCCGCAGGTCGCCTTCACTGTCTCGATCCCACCGCAAGCGGCAATCAGCCGGCTGCAACTGGAGGTG
GATGGGCAAACCCTGGAGGTGCGCGAAGGCGCGCGTGCCAGCCAGTCGATGACCTGGCCCGGACCCAATC
CGGGCCTGGTGCGTGTCGCGGCGTGGGACGCCAGCGGGCAGGCCTTGCCGGTGCTCGAATACCGCGGTCC
CTGGGCCTGGTTTCGGGCGCTGCAGGCCGGGCGGCTGCGCCGCAGCGGCGATCTGGACTACACCGCCAGC
CTCGCCCTGGGCAGCGCCACGGTACGGATGGACGTCCAGCCGGCGAGCCTGCGGCATCCCTTTGCGGCAT
CGGCCGTGCAGCGGTTCAGTTGCCCATGA
 Primer design