SecReT6
Protein ID: 78049765
SecReT6 ID102
T6SS typeN/A
Gene symbol-
Locus tagXCV4209
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]4830299..4833823 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ3BMS3
KEGG IDxcv:XCV4209
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.80E-91, Aligned region: 189..451
ImcF-related_N [PF14331], Evalue: 2.80E-91, Aligned region: 887..938
IcmF-related [PF06761], Evalue: 2.10E-68, Aligned region: 502..800
DUF1215 [PF06744], Evalue: 6.90E-29, Aligned region: 916..1038
AAA_22 [PF13401], Evalue: 0.0011, Aligned region: 127..264
AAA_22 [PF13401], Evalue: 0.0011, Aligned region: 429..481
Protein Sequence: 1174 a.a.     [Download]
>gi|78049765|ref|YP_365940.1| hypothetical protein XCV4209 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MKTLLSKLSATVVVGLLALCLLSVLLWVGGPYVALAGWSPLSSVAARLLAIVLLVVAWVGVLALRRWRTQ
ARAATLSSALAAPGRDDDRELRSGQERAQLQARFQQAIQLLRKRRGGADLYTLPWYALIGPPGSGKCTLL
QHSGLQFPLAARMGDAALRGVGGTRDCEWWFTDEAVLLDTAGRYTTQDSDQAVDAGAWRDFLRLLRRYRP
RRPLNGVLVTMSMSDLLLLDDAERDTHMQAIRRRLDELAEQLQASVPVYLIFTKCDLIGGFGEFFDDLTP
AQRNQVWGMTFALAQTLDGQAARRFADEFGVLQQQLSARLFERLHLERDRLRRAAILSFPQQVAALGERA
RQFVEGTFAGNAYGPAPLLRGVYFTSGTQDGTPIDRMMGAVARTFGLEEARVQAPGAQRRTFFVERLLRE
VVLRESGLANTPPTRQRRRAWLQAAAYAGVALLTGAVLAGLGLSYVGNRAYLHQVRAALDARPAVPDPNA
ATGMPEYVARTLQQADATQAVVKVAQQYHAGAPWSLRMGLFQGQAVGEQVQAGYLRQLNATLLPALAVRL
RTGLVDNAQAPQALYYTLKGYLMLGQPQHLDPAQLSALAAIEAVKLFPREPALQQALGAHLQAVLESPTR
ARALSLDNQRIAQARASLRAANLSTLIYGNLLLTPPDGTPLRLDKALGLLADTFVRRSGTALSTPVPALY
TQPVFAALQRDGIGQAVERFGRDDWVFGGAALDASAKATLVREVGQRYTADYIRYWDALLADLQLRPSAD
LAGASATAAKLAGPSSPLRLLLGVVGEHTQAMDRAPPVDPAQRALAAAANSAGTKATAAAAKLPGGAAMS
AALATPAEGGAAAAPAPGAAISEHFLALNALAAGAPGSTPLDHLLSVLDQLGRQLLVISQGGGDAAAANA
QLALARQEMAQLPPPVTDWLQSLAGSSATLMTQGARAALDAQVRQSVGEVCTDFVRGRYPFDPQAQVEIP
LQNFGDLFGSGGRLDALYTGTVKPLLDTQSPQWRWKDGPDAVTGAPGLPVQLQLAQRIRQKYFRGGPTPQ
IGFTVLAPTLGEGVTRLTLDIEGQRYDYQPGAAQSMPMIWPGPVPGHVSIAAFGADGVALGTLDYQGDWA
LFRALQAGHLENPSDLRFVARFALGGHDVQVPLRAGNLRHPFLDSDVQHFACGR
 
Nucleotide Sequence: 3525 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c4833823-4830299 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGAAGACGCTGTTGTCCAAGCTGAGCGCAACGGTAGTGGTTGGCCTGCTGGCGCTGTGCCTGCTGTCGG
TGCTGCTGTGGGTGGGTGGGCCGTATGTGGCGCTGGCCGGCTGGAGCCCGCTGAGCAGCGTGGCGGCGCG
GCTGCTGGCGATCGTGTTGCTGGTGGTGGCGTGGGTGGGCGTGCTGGCGCTGCGCCGCTGGCGCACGCAG
GCACGTGCGGCGACCTTGTCCAGCGCGCTGGCGGCGCCGGGTCGCGACGACGACCGTGAGCTGCGCAGCG
GGCAGGAACGCGCGCAGCTGCAGGCGCGCTTCCAGCAGGCGATCCAGTTGCTACGCAAGCGGCGCGGCGG
CGCCGATCTGTACACGCTGCCGTGGTATGCGCTGATCGGCCCGCCCGGTTCGGGCAAGTGCACCTTGCTG
CAGCATTCGGGCCTGCAGTTTCCGCTGGCTGCGCGCATGGGCGATGCGGCGTTGCGCGGCGTCGGCGGCA
CCCGCGATTGCGAATGGTGGTTCACCGACGAAGCGGTGTTGCTGGACACCGCCGGGCGCTATACCACGCA
GGATTCGGACCAGGCGGTGGATGCCGGCGCGTGGCGCGATTTCCTGCGCCTGTTGCGACGCTATCGCCCG
CGCCGCCCGCTCAACGGCGTGTTGGTGACGATGAGCATGTCGGACCTGTTGCTGCTCGACGATGCCGAGC
GCGACACCCACATGCAGGCGATCCGCCGCCGCCTGGACGAACTGGCCGAGCAGTTGCAGGCCAGCGTGCC
GGTGTATCTGATCTTCACCAAGTGCGATCTGATCGGCGGCTTTGGCGAGTTCTTCGACGATCTGACGCCG
GCGCAGCGCAACCAGGTGTGGGGCATGACGTTTGCGCTGGCGCAGACCCTGGACGGGCAGGCGGCGCGCA
GGTTCGCCGACGAGTTCGGCGTGCTGCAGCAGCAGCTGAGCGCGCGCCTGTTCGAACGCCTGCACCTGGA
ACGCGACCGTCTGCGGCGTGCGGCAATCCTGTCGTTTCCGCAACAGGTTGCCGCACTCGGCGAGCGTGCG
CGGCAATTCGTCGAAGGCACCTTCGCCGGCAATGCGTATGGCCCGGCACCGTTGCTGCGCGGGGTGTACT
TCACCTCCGGCACGCAGGACGGCACGCCGATCGACCGCATGATGGGCGCGGTGGCGCGCACCTTCGGCCT
GGAAGAAGCGCGCGTGCAGGCGCCGGGCGCGCAACGGCGCACCTTTTTCGTCGAGCGGCTGCTGCGCGAG
GTGGTGCTGCGCGAATCCGGCCTGGCCAATACCCCGCCCACCCGGCAGCGCCGCAGGGCGTGGTTGCAGG
CCGCCGCGTACGCGGGTGTGGCGCTGCTGACCGGCGCAGTGCTGGCCGGGTTGGGGCTCAGCTACGTGGG
CAACCGTGCGTACCTGCATCAGGTACGCGCTGCGCTGGACGCGCGGCCGGCAGTGCCCGATCCCAATGCC
GCCACCGGCATGCCCGAGTACGTCGCGCGCACCCTGCAGCAAGCCGATGCGACGCAGGCGGTGGTGAAGG
TGGCGCAGCAGTATCACGCCGGCGCGCCGTGGTCGTTGCGCATGGGGTTGTTCCAGGGCCAGGCGGTGGG
CGAGCAAGTGCAGGCCGGCTACCTGCGTCAGCTCAACGCCACCTTGTTGCCGGCCTTGGCGGTGCGCCTG
CGCACCGGTCTGGTCGATAACGCACAGGCACCGCAGGCGCTGTACTACACGCTCAAGGGCTATCTGATGC
TGGGCCAGCCGCAGCATCTGGACCCGGCGCAACTCAGCGCACTGGCCGCCATCGAAGCGGTAAAATTGTT
CCCGCGCGAGCCGGCATTGCAGCAGGCGCTGGGTGCGCATCTGCAGGCCGTGCTGGAGTCGCCCACGCGC
GCGCGCGCGCTGTCGCTGGACAACCAGCGCATCGCCCAGGCGCGCGCCAGCCTGCGCGCGGCCAACCTAT
CGACACTGATCTACGGCAACCTGTTGCTGACCCCGCCGGACGGCACGCCGTTGCGGCTGGATAAAGCGCT
GGGCCTGCTGGCCGACACCTTCGTGCGCCGCAGTGGCACGGCGTTGTCCACCCCGGTGCCGGCGCTCTAC
ACCCAGCCGGTATTCGCCGCGTTGCAACGCGATGGCATCGGCCAGGCGGTGGAACGCTTCGGCCGCGACG
ATTGGGTCTTCGGCGGTGCGGCGCTGGACGCGTCCGCCAAGGCCACGCTGGTGCGCGAAGTGGGACAGCG
CTACACGGCCGATTACATCCGTTACTGGGATGCGTTGCTGGCCGATCTGCAACTGCGCCCGTCGGCCGAT
CTGGCCGGTGCCAGCGCCACTGCCGCCAAGCTGGCCGGGCCCAGTTCGCCACTGCGGCTGCTGCTGGGCG
TGGTCGGCGAGCACACCCAGGCAATGGACCGCGCACCACCGGTAGACCCCGCGCAGCGCGCGCTGGCAGC
TGCCGCCAACTCGGCAGGCACCAAGGCGACTGCCGCCGCGGCCAAACTCCCCGGCGGGGCGGCGATGAGC
GCCGCGCTGGCCACGCCCGCCGAGGGTGGCGCAGCTGCAGCGCCGGCACCGGGTGCGGCGATCAGCGAGC
ATTTTCTGGCACTCAACGCCTTGGCCGCCGGCGCCCCGGGCAGCACGCCGCTGGACCATCTGCTGAGCGT
GCTCGATCAGCTCGGCAGGCAATTGCTGGTGATTTCCCAGGGCGGCGGCGATGCCGCGGCGGCCAACGCG
CAACTGGCATTGGCCCGGCAGGAAATGGCGCAACTGCCGCCGCCGGTGACCGACTGGCTGCAGAGCCTGG
CCGGCAGCAGCGCCACCTTGATGACCCAGGGCGCACGCGCCGCGCTGGATGCGCAGGTCAGGCAATCGGT
GGGCGAGGTGTGCACGGATTTCGTGCGCGGCCGCTACCCGTTCGATCCGCAGGCGCAGGTGGAGATCCCG
CTGCAGAATTTCGGCGACTTGTTCGGTAGCGGCGGCCGTCTGGATGCGCTGTATACCGGCACCGTCAAAC
CGCTGCTGGACACCCAGTCCCCGCAATGGCGCTGGAAGGATGGCCCGGACGCGGTCACCGGCGCGCCCGG
TCTGCCGGTGCAACTGCAACTGGCGCAGCGGATCCGGCAGAAATATTTTCGCGGCGGGCCCACGCCGCAG
ATCGGCTTTACCGTGCTGGCGCCCACGTTGGGCGAAGGCGTGACCCGGCTGACGCTGGATATCGAAGGCC
AGCGCTACGACTACCAGCCCGGCGCTGCGCAAAGCATGCCGATGATCTGGCCCGGCCCGGTGCCGGGGCA
TGTGTCCATCGCCGCCTTCGGCGCCGATGGCGTGGCGCTGGGTACGCTGGACTACCAGGGCGATTGGGCG
CTGTTCCGCGCGCTGCAGGCCGGGCACCTGGAAAACCCGTCGGACCTGCGCTTTGTCGCCCGCTTCGCGC
TTGGCGGCCACGACGTGCAGGTGCCGCTGCGTGCCGGCAACCTGCGCCACCCGTTTCTGGACAGCGACGT
CCAGCACTTCGCGTGCGGCCGATGA
 Primer design