SecReT6
Protein ID: 78061842
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0992
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1110148..1114257 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ398K5
KEGG IDbur:Bcep18194_B0992
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.10E-97, Aligned region: 641..965
ImcF-related_N [PF14331], Evalue: 1.70E-91, Aligned region: 324..594
ImcF-related_N [PF14331], Evalue: 1.70E-91, Aligned region: 975..1021
DUF1215 [PF06744], Evalue: 3.20E-34, Aligned region: 962..991
DUF1215 [PF06744], Evalue: 3.20E-34, Aligned region: 1075..1198
Protein Sequence: 1369 a.a.     [Download]
>gi|78061842|ref|YP_371750.1| hypothetical protein Bcep18194_B0992 [Burkholderia sp. 383]
MKKFQFLSFLASRQFLAFLALIVVALVIWFVGPFFAFGGLKPLASAGMRVLLIALLLAGVLLWLVGWSTI
VVFAALLCLLIWYAAPLLSFGHVAPFEAVSARLTAIALVAGAFVLFGMFRLWQKMREDDAFLKKMLRMDR
RKDDSPAAPRLRQVEGIMTSALARLKSMRTGARGPGKLFQGKRYLYELPWYITLGSQGSGKTSVLTNGGL
VFPVAEQMQRATGAPIGDAAAVEWWMTNDAVLIDTAGYYAHHGMSTAEDVDAPVSETGKPATGVPGKDGA
DTGPAAEGAEDDAKRNEASQSKAAAVSAASGSAVPPGQGAGERRQKVDRAEWFGFLGMLRRHRPRAPING
ALLTIDLATLAGADEQARVAEAAMLRARLAELRQELGIRFPVYVMVTKMDRLTGFAECFGTLTAEGRVQA
WGFTLPYGKETVAKEGVRERCRAELAELAQRLGGSIDTHLQDEYDPRKRRSLAALPEEFSALLEPLLDLI
DRVFLDSRYDDTQLHSTLRGVYFTSARQRGSEIVAERGTVVQRLLSTQDHAPVSSVRAEGNQGFFLHDLL
TRVVFPEAHLVRPNLRWEYRYRLLRLIGHTLALLVFVWLAIGLRASFGNNGDYLDAIGRKVKALTTRVTQ
LYKEPKPESVPDTLTEARYLATFPGLDLSNPDSTWRYGLYTPADIATESRHAYDALEDNLLLPQIVYRLE
DVMSGAIASKAPKAAYDALRVYLMLYDKAKFNAADVKAWVLDDWAKTDSAAVFGGRASMIDHVQQLFSGE
RVVQSPLIRNDALVQQARAFLDGSNATDRLYQRAKAAMLKEAPDEFTLLRAVGPQAGTVFTRASDAPLSR
GVAGLFTFDGYRNLFDKRLPEFVQIARDDDAWVMGRSYLAGSSDLAQKKTAEIVSNATGVDDALTDAVRR
EYLMEYAQQWDAFLNDIRTVSGTSLAFNLKVLGSFAAPDSPLVRLARAAVHETTLTQAMAVSDGALLQRA
ADQLNQKADKALGIRASERVERELVDNHFAALREVVTGSVDAQSDTRPAATQADKTGLDGVTNLLNDYYT
ALTVADNALSNNSMPPASDVAAKLKMAADTMPAPFRAVLLQLASDGSREVNQGIGQLLSRQMQAVVGDTC
RLIVEGNYPFSPDSKRDVSIDDFTRVFAQGGLIDDFFTKTLAPFVDTAAKPWRYRTLPGATEPMQGPDLE
PFEHAKAIRDVFFNDPGRKQMTWKADIRIPELDPTIMSLSLDIDGQTTLYQHGPVAPFTVTWPGPRGGVH
TEITASPRIRPDTSTIAADGPWALMRLLQNGRVVETATPGRTRIAFGFDGRQAALDVASAGSVANPLTSD
VLKTFRCPSTMSAFNLPDSGPPPGLPRGMLPASAGSASR
 
Nucleotide Sequence: 4110 bp     [Download]
>gi|78060853|ref|NC_007511.1|:1110148-1114257 Burkholderia sp. 383 chromosome 2, complete sequence
ATGAAGAAGTTCCAGTTCCTGTCGTTTCTGGCCTCGCGCCAGTTCCTCGCGTTCCTTGCACTGATCGTCG
TTGCATTGGTGATCTGGTTCGTCGGCCCGTTTTTCGCGTTCGGCGGGCTCAAGCCGCTCGCCAGTGCCGG
CATGCGTGTGCTGCTGATCGCGCTGTTGCTCGCCGGCGTGTTGCTCTGGCTCGTGGGCTGGTCGACGATC
GTCGTGTTTGCCGCATTGCTTTGCTTGTTGATCTGGTATGCGGCACCGCTGCTCTCGTTCGGTCATGTGG
CGCCGTTCGAGGCGGTGTCGGCTCGGCTCACCGCGATCGCGCTGGTGGCGGGCGCTTTCGTTCTTTTCGG
GATGTTCCGTCTGTGGCAGAAGATGCGGGAAGACGATGCGTTCCTGAAGAAGATGCTGCGCATGGACCGC
CGCAAGGATGATTCACCCGCTGCACCGCGCTTGCGTCAAGTCGAAGGGATCATGACGAGCGCGCTCGCGC
GTCTCAAATCGATGCGTACCGGCGCGCGAGGTCCTGGCAAGCTGTTCCAGGGCAAGCGCTATTTGTACGA
ACTGCCCTGGTACATCACGCTCGGCTCGCAAGGGTCCGGCAAGACCAGCGTACTGACGAACGGCGGATTG
GTGTTTCCCGTTGCAGAGCAGATGCAGCGCGCGACCGGCGCACCGATCGGTGACGCCGCCGCGGTGGAAT
GGTGGATGACCAATGACGCGGTGCTGATCGACACGGCCGGCTACTACGCGCATCACGGCATGTCGACGGC
CGAGGACGTCGACGCGCCCGTCTCGGAAACGGGAAAGCCGGCAACCGGCGTTCCGGGCAAGGACGGCGCC
GATACCGGGCCGGCTGCGGAGGGCGCCGAAGACGATGCGAAGCGCAATGAGGCGTCGCAATCGAAAGCCG
CCGCCGTGTCCGCAGCCAGCGGCTCTGCCGTTCCGCCCGGTCAAGGTGCGGGGGAACGCCGGCAGAAGGT
CGATCGTGCGGAATGGTTCGGATTTCTGGGCATGCTGCGCCGGCATCGGCCTCGCGCGCCGATCAACGGT
GCGTTGTTGACGATCGATCTCGCCACGTTGGCGGGCGCCGACGAACAGGCGCGAGTGGCTGAGGCTGCCA
TGTTGCGCGCGCGGCTGGCCGAACTGAGGCAGGAACTGGGTATTCGCTTTCCTGTTTATGTGATGGTCAC
GAAGATGGACCGTCTGACGGGTTTCGCCGAGTGTTTCGGGACGCTGACGGCCGAGGGGAGAGTGCAGGCA
TGGGGCTTCACGCTTCCGTATGGCAAGGAAACGGTTGCGAAGGAAGGCGTGCGCGAGCGCTGCCGCGCCG
AGCTTGCCGAACTCGCACAACGGCTCGGCGGTTCGATTGATACCCATCTTCAGGATGAGTACGATCCCCG
CAAGCGCCGGTCGCTTGCGGCATTGCCCGAGGAATTTTCGGCGCTGCTCGAACCGCTGCTCGACCTGATC
GATCGGGTATTTCTCGACTCACGGTACGACGATACCCAACTCCACTCGACGTTGCGCGGCGTGTATTTCA
CGAGTGCGCGGCAACGGGGCAGCGAGATCGTCGCGGAGCGCGGTACAGTCGTTCAACGCCTTCTGTCGAC
CCAGGACCACGCTCCCGTGTCGTCGGTACGCGCCGAAGGCAACCAGGGCTTCTTCCTGCATGACCTCCTG
ACTCGCGTCGTGTTCCCGGAAGCGCATCTGGTGAGGCCCAACCTGCGCTGGGAATACCGCTACCGGCTGT
TGCGCCTGATCGGCCACACATTGGCGCTGCTGGTGTTCGTGTGGCTGGCCATCGGCCTGCGTGCAAGCTT
CGGCAACAACGGCGACTATCTCGATGCAATCGGCCGCAAGGTGAAGGCGCTCACGACCCGCGTCACCCAA
CTCTACAAGGAACCCAAGCCGGAATCGGTGCCCGACACGCTGACCGAGGCCCGCTATCTGGCGACCTTCC
CGGGGCTGGACCTGTCGAATCCGGACAGTACGTGGCGCTACGGTCTCTATACGCCAGCGGACATCGCCAC
CGAAAGCCGCCATGCGTACGACGCCCTCGAGGACAACCTGCTGCTGCCGCAGATCGTGTACCGCCTGGAA
GACGTCATGTCCGGTGCGATCGCCAGCAAGGCTCCAAAGGCGGCCTACGATGCGCTGCGTGTCTACCTGA
TGTTGTACGACAAGGCGAAGTTCAACGCCGCGGACGTCAAGGCCTGGGTGCTTGACGACTGGGCGAAGAC
CGACAGCGCGGCGGTTTTCGGTGGACGTGCGTCGATGATCGACCACGTGCAGCAGCTTTTCTCCGGAGAG
CGCGTGGTGCAATCGCCGCTGATTCGCAACGATGCGCTGGTGCAGCAGGCGCGCGCGTTTCTCGACGGCA
GCAACGCAACCGATCGCCTTTATCAGCGTGCGAAGGCGGCGATGCTCAAGGAAGCGCCCGACGAGTTTAC
GCTCCTGCGCGCGGTCGGCCCGCAGGCCGGCACGGTGTTCACGCGGGCGAGCGACGCACCATTGTCGCGT
GGCGTGGCGGGGCTTTTCACGTTCGACGGCTATCGGAATCTGTTCGACAAGCGCTTGCCCGAATTCGTGC
AGATCGCGCGAGATGACGATGCGTGGGTGATGGGGCGCTCGTATCTGGCGGGTTCGTCGGATTTGGCTCA
AAAAAAAACGGCTGAGATCGTGAGCAACGCGACTGGCGTGGACGATGCGCTGACCGACGCGGTCCGTCGC
GAATACCTGATGGAATATGCGCAGCAGTGGGACGCGTTTCTCAACGACATCCGGACCGTGAGCGGCACGA
GCCTTGCGTTCAATCTGAAGGTGCTGGGCAGCTTCGCGGCGCCTGATTCGCCGCTCGTGCGGCTTGCGCG
GGCAGCCGTGCACGAGACGACGCTCACGCAGGCGATGGCTGTGTCGGACGGGGCGCTGCTGCAGCGAGCC
GCCGACCAGCTCAATCAGAAGGCGGACAAGGCGTTGGGCATTCGAGCATCGGAGCGCGTTGAACGGGAAC
TCGTCGACAATCACTTTGCGGCGCTGCGCGAGGTCGTAACCGGGAGCGTGGATGCGCAATCCGATACACG
GCCAGCCGCCACGCAGGCGGACAAGACGGGGCTGGACGGCGTCACCAACCTGCTGAACGACTATTACACG
GCGCTCACGGTTGCCGACAATGCGTTGTCGAACAACAGCATGCCACCGGCGAGCGACGTAGCCGCGAAAC
TGAAAATGGCGGCCGACACGATGCCCGCACCGTTCCGCGCGGTATTGCTGCAGCTTGCCTCCGATGGCTC
GCGCGAAGTCAATCAAGGCATCGGCCAATTGCTGTCGCGTCAGATGCAGGCGGTGGTCGGCGACACATGC
CGGCTGATTGTCGAGGGTAACTATCCGTTTTCGCCGGACAGCAAGCGCGATGTCAGCATCGACGATTTCA
CCCGGGTGTTTGCACAAGGGGGCTTGATCGATGACTTCTTCACGAAAACGCTTGCACCGTTCGTCGACAC
AGCCGCGAAGCCTTGGCGCTACCGGACGCTGCCGGGCGCGACCGAACCCATGCAGGGGCCAGACCTGGAG
CCGTTCGAGCATGCGAAGGCCATCCGCGACGTCTTCTTCAACGATCCCGGCCGCAAGCAGATGACGTGGA
AGGCCGACATCCGGATTCCCGAACTCGATCCGACGATCATGAGTCTCTCGCTCGACATCGACGGACAGAC
GACGCTTTACCAACATGGTCCTGTTGCGCCTTTCACTGTCACATGGCCGGGGCCGCGCGGCGGCGTCCAC
ACGGAAATCACGGCCAGCCCGCGGATTCGGCCGGATACGTCGACGATCGCAGCAGACGGACCGTGGGCGT
TGATGCGCCTGCTCCAGAACGGTCGTGTGGTGGAGACGGCAACGCCGGGCCGCACGCGCATCGCGTTCGG
TTTCGACGGTCGTCAGGCAGCACTCGACGTCGCAAGTGCCGGGAGCGTCGCTAATCCGCTGACGAGTGAC
GTGCTGAAGACGTTCCGGTGCCCCAGCACGATGTCGGCGTTCAACCTGCCGGATAGTGGCCCGCCGCCGG
GGTTGCCGCGAGGCATGTTGCCGGCAAGCGCGGGTAGCGCTTCCCGCTGA
 Primer design