SecReT6
Protein ID: 78062442
SecReT6 ID106
T6SS typei3
Gene symbol-
Locus tagBcep18194_B1592
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1809587..1813213 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ396A5
KEGG IDbur:Bcep18194_B1592
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.80E-95, Aligned region: 214..478
IcmF-related [PF06761], Evalue: 1.00E-92, Aligned region: 370..391
IcmF-related [PF06761], Evalue: 1.00E-92, Aligned region: 526..837
DUF1215 [PF06744], Evalue: 1.30E-34, Aligned region: 65..87
DUF1215 [PF06744], Evalue: 1.30E-34, Aligned region: 944..1068
Protein Sequence: 1208 a.a.     [Download]
>gi|78062442|ref|YP_372350.1| hypothetical protein Bcep18194_B1592 [Burkholderia sp. 383]
MNQAVARFVRPLPSREIWTFAGLVVLACFVWLAGPLFAFAEVRPLESGWARGLTIAVLFIAWGARVAWRS
WRAGRLNAQLLNQLREAAPGPATADDPAKAQLDELRSRFDEAASLLKKVRFGQADTVRKGLPRWFDRMSR
QYLYQLPWYVFIGAPGSGKTTALVNSGLSFPLAEQFGRAAIRGVGGTRHCDWWFTNDAVLIDTAGRYTTH
EGNRALDEAEWKGFVDLLKKYRTRQPLNGAMLTISVADLLGASEAERTQHAMVLRKRLLELRAQLGIRFP
VYLLVTKADLLAGFAEYFSSYGRTECAQVWGFTFPLAQSEAPGFDLRAAFDREYRLLHQRLNDGLPELLA
AQTDARQREMTYLLPQQIADLQDMLGQFVAEVFSVSSYEPMPMLRGVYLTSGTQEGTAFDRVMSGIKRFL
KIEGVPPVAQVGSTGRSFFLKSLLQEHIFREAALAGSDLRWHQKRRVLQIVGYVLLALVCVAVLVAWLRS
YSNNRAYLDQIAARVPAVDAQIAGAKFSDAADVARLLPVLDALGNLANAGGVDLQHPPLAYRWGLFQGEK
IDEAVDAVYRRALEDVLLPIAARRMEAALRDARPDETEYAYAALKAYLMLYDSAHYDPAFVQAVVDLEME
RALPPDFSPAERTALRAHLAALFGNRVAVSPYPMNERLVADVRDRLRQVPFSQRLYRQLTLTLRPATSAF
DFSVARAVGPDASLVFRRQSGKPLSEGVPGLYTRNGYRNVFAPRLAGEVDTYGREEVWVLNLGLSEIPGP
NDAAAWARDIRQLYLNDYLKIWDDYLADIKLQRTATLAQSIQVARALSSADSPLTRLMVALARDTALGDA
PGGARNLAARAQDKVDEARSSLSQIFAGQGSDSSASAAAPASAEQIVDSHFAGLRAFAPGSGDQAQAFSE
VLKSIDALYTYLTATDDALRSGAQPPPSDAPARLRAQAGRLPTPFREVLDDLSNVANGSVATVEQRSVAT
RAGANVGDFCRQAIAGRYPFARGSSRDVAPADFAQMFAPGGLMDDFFQKNLQSIVDTTSHPWRFANRNAD
ADPSAAAMLASFEKAAVIRDAYFGGGARTAQLKVQIQPLEMDPSITEMVLDVDGQIVRYAHGPLVQSAVD
WPGPRGSNQVRLQVSGQAGATDGFSTDGPWALHRLFDRAAVSAGRGSDQMIARFTVDGKPIVLQVNAGSV
RNPFRLPQMESFTCPPKP
 
Nucleotide Sequence: 3627 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1813213-1809587 Burkholderia sp. 383 chromosome 2, complete sequence
ATGAACCAGGCTGTCGCGCGTTTCGTCCGGCCGTTGCCGTCGCGGGAGATCTGGACTTTCGCCGGTCTCG
TCGTGCTCGCGTGCTTCGTGTGGCTCGCAGGCCCGCTGTTCGCGTTCGCCGAGGTCCGGCCGCTCGAAAG
CGGCTGGGCGCGCGGGCTCACGATCGCGGTGCTGTTCATCGCGTGGGGCGCGCGTGTCGCATGGCGCAGC
TGGCGCGCGGGCCGCCTCAACGCGCAGTTGCTGAACCAGCTGCGCGAGGCCGCTCCCGGGCCGGCCACCG
CCGACGATCCGGCAAAGGCGCAGCTCGACGAGTTGCGCAGCCGCTTCGACGAGGCCGCTTCGCTGCTGAA
GAAGGTGCGCTTCGGACAGGCCGACACCGTGCGCAAGGGCCTGCCGCGCTGGTTCGACCGGATGTCGCGC
CAGTATCTGTATCAGCTGCCTTGGTACGTGTTCATCGGCGCGCCGGGCTCGGGCAAGACCACCGCGCTCG
TGAATTCCGGGCTCAGCTTTCCGCTCGCGGAGCAGTTCGGCCGCGCGGCGATTCGCGGCGTGGGCGGCAC
GCGGCATTGCGACTGGTGGTTCACGAACGACGCGGTGCTGATCGACACCGCCGGCCGTTACACGACGCAC
GAGGGCAATCGCGCGCTCGACGAGGCCGAGTGGAAAGGCTTCGTCGACCTGCTGAAGAAATACCGCACGC
GCCAGCCGCTGAACGGCGCGATGCTGACGATCAGCGTCGCCGACCTGCTCGGCGCGTCGGAGGCCGAACG
CACGCAGCACGCGATGGTGCTGCGCAAGCGGCTGCTCGAACTGCGCGCGCAGCTCGGCATTCGCTTTCCC
GTGTACCTGCTCGTGACGAAGGCCGACCTGCTGGCGGGCTTCGCCGAGTATTTCAGCAGCTACGGCCGCA
CCGAATGCGCGCAGGTGTGGGGCTTTACGTTCCCGCTCGCGCAGAGCGAGGCGCCGGGTTTCGACCTGCG
CGCGGCGTTCGACCGTGAATACCGGCTGCTGCACCAGCGGCTGAACGACGGACTGCCCGAACTGCTCGCC
GCGCAGACCGACGCGCGCCAGCGCGAAATGACGTACCTGCTGCCGCAGCAGATCGCCGACCTGCAGGACA
TGCTCGGCCAGTTCGTCGCCGAGGTGTTTTCGGTGTCGAGCTACGAGCCGATGCCGATGCTGCGCGGCGT
CTACCTGACGAGCGGCACGCAGGAGGGCACCGCGTTCGATCGCGTGATGAGCGGCATCAAGCGTTTCCTG
AAGATCGAGGGCGTGCCGCCGGTCGCGCAGGTCGGCTCGACCGGGCGCAGCTTCTTCCTGAAGTCGCTGC
TGCAGGAACACATCTTCCGCGAAGCCGCGCTCGCCGGCAGCGACCTGCGCTGGCATCAGAAGCGGCGCGT
GCTACAGATCGTCGGCTACGTGCTGCTCGCGCTGGTGTGCGTGGCCGTGCTGGTCGCGTGGCTGCGCAGC
TATTCGAACAATCGCGCGTATCTCGACCAGATCGCCGCGCGCGTGCCGGCCGTCGATGCGCAGATCGCCG
GCGCGAAATTCTCCGATGCGGCCGACGTCGCCCGCCTGTTGCCCGTGCTCGACGCGCTCGGCAACCTCGC
GAATGCGGGCGGCGTCGACCTGCAGCATCCGCCGCTTGCGTATCGGTGGGGGCTGTTCCAGGGCGAGAAG
ATCGACGAAGCCGTCGACGCCGTGTACCGGCGCGCGCTCGAAGACGTGCTGCTGCCGATCGCCGCGCGCC
GGATGGAGGCCGCGCTGCGCGACGCACGGCCCGACGAGACCGAATACGCGTATGCGGCGCTGAAGGCGTA
CCTGATGCTGTACGACAGCGCGCACTACGATCCCGCGTTCGTGCAGGCCGTCGTCGATCTCGAAATGGAA
CGCGCGCTGCCGCCCGATTTCTCGCCGGCCGAACGCACCGCGCTGCGTGCGCATCTCGCCGCGCTGTTCG
GCAACCGTGTCGCGGTGTCGCCGTATCCGATGAACGAGCGGCTCGTGGCCGACGTGCGCGACCGCTTGCG
GCAGGTGCCGTTCTCGCAGCGGCTGTACCGGCAGCTCACGCTCACGCTGCGGCCGGCCACGTCCGCGTTC
GACTTCAGCGTCGCGCGGGCGGTCGGCCCCGATGCTTCACTGGTGTTCCGCCGCCAGAGCGGCAAGCCGC
TGTCGGAAGGCGTGCCGGGGCTCTATACGCGCAACGGCTATCGCAATGTGTTCGCGCCGCGCCTGGCCGG
CGAGGTCGACACCTACGGGCGCGAGGAAGTGTGGGTGCTGAACCTCGGGTTGTCCGAGATTCCGGGCCCG
AACGACGCTGCCGCGTGGGCGCGCGATATCCGCCAGCTCTACCTGAACGACTACCTGAAGATCTGGGACG
ACTATCTCGCCGACATCAAGCTGCAGCGCACGGCGACGCTCGCGCAGAGCATCCAGGTGGCGCGCGCGCT
GTCGTCCGCCGATTCGCCGCTCACGCGGCTGATGGTCGCGCTCGCACGCGATACCGCGCTCGGCGATGCA
CCGGGCGGGGCGCGCAATCTCGCCGCGCGCGCGCAGGACAAGGTCGACGAGGCGCGCAGCTCGCTGTCGC
AGATCTTCGCGGGCCAGGGCAGCGATTCGAGCGCGTCCGCGGCGGCGCCCGCGAGCGCCGAGCAGATCGT
CGACAGCCACTTCGCCGGGCTGCGCGCGTTCGCGCCGGGCAGCGGCGACCAGGCCCAGGCGTTCAGCGAG
GTGCTGAAGTCGATCGACGCGCTGTACACGTACCTGACGGCCACCGACGACGCCTTGAGAAGCGGCGCGC
AACCGCCGCCGTCCGACGCGCCAGCCAGGCTGCGCGCACAGGCCGGCCGCCTGCCGACACCATTCCGCGA
AGTGCTCGACGACCTGTCTAACGTCGCGAACGGCAGCGTCGCGACTGTCGAGCAGCGCAGCGTCGCGACG
CGGGCCGGTGCGAACGTCGGTGACTTCTGCCGGCAGGCGATCGCGGGCCGCTATCCGTTCGCGCGTGGCT
CGTCACGCGACGTCGCGCCGGCGGATTTCGCGCAGATGTTCGCGCCCGGCGGCCTGATGGACGACTTCTT
CCAGAAGAACCTGCAGTCGATCGTCGATACGACGTCGCACCCGTGGCGCTTCGCGAACCGCAATGCGGAC
GCCGATCCGTCGGCCGCCGCGATGCTTGCTTCGTTCGAGAAGGCGGCGGTGATCCGCGACGCCTATTTCG
GCGGCGGCGCACGCACCGCGCAGTTGAAGGTACAGATCCAGCCGCTCGAAATGGACCCGTCGATCACGGA
GATGGTGCTCGACGTCGACGGGCAGATCGTCCGCTACGCGCACGGCCCGCTCGTGCAGAGTGCGGTGGAC
TGGCCGGGCCCGCGCGGCAGCAACCAGGTGCGGCTGCAGGTGTCCGGGCAGGCCGGCGCGACCGACGGCT
TCTCGACCGACGGGCCGTGGGCGCTGCACCGGTTGTTCGACCGCGCGGCCGTGTCGGCCGGACGCGGCTC
GGACCAGATGATTGCGCGGTTCACGGTCGACGGCAAACCGATCGTGCTGCAAGTGAATGCGGGCAGTGTC
CGCAACCCGTTCAGGCTGCCCCAGATGGAGTCCTTTACATGCCCTCCGAAGCCATGA
 Primer design