SecReT6
Protein ID: 78065051
SecReT6 ID104
T6SS typei4b
Gene symbol-
Locus tagBcep18194_A3575
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007510] [Browse all T6SS(s) in this replicon]
Location [Strand]443878..447825 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ39K40
KEGG IDbur:Bcep18194_A3575
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.40E-71, Aligned region: 193..451
IcmF-related [PF06761], Evalue: 4.90E-52, Aligned region: 498..877
DUF1215 [PF06744], Evalue: 3.00E-29, Aligned region: 1010..1125
Protein Sequence: 1315 a.a.     [Download]
>gi|78065051|ref|YP_367820.1| unnamed protein product [Burkholderia sp. 383]
MQRILNVLTHPRTLSIVGIVALAAILFIVADMLQLPLLWAAIAFATILALWLVVALWRRWRVKRANQQLG
QVLEEQAETGKIAAPAAAALAPDSKTADLDVLRTRLSDAVKTIKTSKIGQVSGGSALYELPWYIVIGNPA
AGKSSAVLNSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKRY
RPKAPINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSS
DKHEYDRVWGATLPYEPDDKRDVVAQFDTHFEELYEGLKEISVAQLSLSRGNQLSPGQLSFPLEFSTIKP
SLRAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGLDGAALPKPHSAFSKNGFFLRD
LFSKVIFADRQTVRQFASPTKTRLRYATFFGFVAALALALGGWTWSTIGNQQLVANVQADLDNVTRLQQG
RNDLQSRLQAMDILEDRIEQLEQFRRDKPVSVSLGLYQGDRLEQHLLTEYYNGVRQILLAPVSQNLASFM
KDVNAHPEQLVPMTRPPESGAVQGGAMPVSTNAAGAAPQAGAALAASGTVPAAAPQQPAAPQGGLYSDAS
PTNVQDAYNALKTYLMLSDKRHVEQAHLTDQLARFWRGWLETNRGNMPRDEMIKSAERMISFYLSRVNDD
DWPMIDANLALVDQTRENLRHVVRGMPARQRVYEEIKARASTRFAPMTIARIVGDGNQGLVAGSYAIPGT
FTREAWFDYVQPAIRDAATKELQAKDWVLNTSTQDDLTLEGSPEQIQKTLVGMYKTEYAQHWQKFMQGIA
VQGFSSFGQAVDGMNRLGDPQDSPIRKILETAYDQTSWDNPSLANVTIKKAQTGVVNWVKQLFSRSQAGQ
VAAANIDINGNPAEVPMGPIGQEFIGLARIVATHDGTSMLKGYMDSLSKVRTRFNVIKNQGDPGPGARQL
MQQTLDGNGSELADSLKLVDEQMLTGLTDSQRKSLRPLLVRPLMQAFAVVIQPASAEVNKVWNAQVYQPF
QNSLATKYPFAASAKVEAGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLAARTWGDMGIGLTPDFTS
GFARWVAPLAGGAAGSAAASSEPQTVFQILPQPSTGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGSP
GATLSATTFDGRTVQLVNEPGRYGLEKLINSAQRKRRPDGTFDLTWAQGSVNVSVTMRIISTSQPSGGGG
DQPQQQSLRGLQLPSSVADASTGAAQNATQSAGTGTPAAAPAVAAANATNAQGAQ
 
Nucleotide Sequence: 3948 bp     [Download]
>gi|78064658|ref|NC_007510.1|:c447825-443878 Burkholderia sp. 383 chromosome 1, complete sequence
ATGCAACGCATCCTCAACGTGCTGACTCATCCGCGTACGCTCTCGATCGTCGGGATCGTCGCGCTAGCGG
CCATTCTCTTCATCGTCGCCGACATGCTGCAACTGCCGCTCCTGTGGGCGGCGATCGCGTTCGCGACGAT
CCTCGCACTGTGGCTCGTCGTCGCGCTGTGGCGCCGCTGGCGCGTGAAGCGCGCGAACCAGCAGCTCGGC
CAGGTGCTGGAAGAGCAGGCGGAAACCGGCAAGATCGCCGCGCCCGCCGCCGCCGCACTCGCCCCCGACT
CGAAGACGGCCGACCTGGACGTGCTGCGCACGCGCCTGTCCGATGCGGTGAAGACGATCAAGACGTCGAA
GATCGGCCAGGTGTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAACCCGGCC
GCGGGCAAGAGCAGCGCCGTGCTCAATTCCGGCCTGCAATTCCCGTTCGCGGACAAGAACAGCGCCGTGA
TCCACGGCATCGGCGGTACGCGTAACTGCGACTGGTTCTTCACGACCGAGGGGATCCTGCTCGACACGGC
CGGCCGCTATTCGGTGCACGAGGAAGACCGCAGCGAATGGCTCGGCTTCCTCGGCCTGCTCAAGCGCTAT
CGCCCGAAGGCGCCGATCAACGGCATCATCGTCACCGCGAGCATCGCCGAACTCACCGGCAACCGCCCCG
AATTTGCGATCAACCTCGCGAAAAACCTCCGTCAGCGCGTTCAGGAGCTGACGGAGAAGCTCGAAGTGTT
CGCGCCGGTCTACGTGATGTTCACGAAGGCCGACCTGATCACCGGCTTCACCGAATTCTTCAGCAGCAGC
GACAAGCACGAGTACGACCGCGTGTGGGGCGCCACCCTGCCCTACGAGCCCGACGACAAGCGCGACGTCG
TCGCGCAGTTCGACACGCACTTCGAGGAACTCTACGAAGGGCTGAAGGAGATCAGCGTCGCGCAGCTGTC
GCTGTCGCGCGGCAACCAGCTGTCGCCGGGCCAGTTGAGCTTCCCGCTCGAATTCTCGACGATCAAGCCG
TCGCTGCGCGCGTTCCTCGCGACGCTGTTCGAGAACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCT
TCTACTTCACCAGCGCGCTGCAGGAAGGCGAAACCAACAGCGCGGCCGCGCAGCGCATCGCGCATCGCTT
CGGCCTCGACGGCGCCGCACTGCCGAAGCCGCACAGTGCGTTCTCGAAGAACGGCTTCTTCCTGCGCGAC
CTGTTCTCGAAGGTGATCTTCGCGGATCGCCAGACGGTGCGGCAGTTCGCGAGCCCGACCAAGACGCGGC
TGCGCTACGCGACCTTCTTCGGCTTCGTCGCGGCGCTTGCGCTCGCGCTCGGCGGCTGGACCTGGTCGAC
GATCGGCAACCAGCAGCTCGTCGCGAACGTGCAGGCCGACCTCGACAACGTCACGCGCCTGCAGCAGGGC
CGCAACGACCTGCAGTCGCGCCTGCAGGCGATGGACATCCTCGAAGACCGGATCGAGCAGCTCGAACAGT
TCCGCCGCGACAAGCCGGTTTCGGTGTCGCTCGGCCTGTACCAGGGCGACCGTCTCGAGCAGCACCTGCT
GACCGAGTACTACAACGGCGTGCGCCAGATCCTGCTGGCCCCGGTGTCGCAGAACCTCGCGTCGTTCATG
AAGGACGTGAACGCGCACCCCGAACAGCTCGTGCCGATGACGCGCCCGCCCGAATCAGGCGCCGTGCAGG
GTGGCGCGATGCCGGTCTCGACGAACGCGGCAGGTGCCGCGCCGCAGGCCGGTGCCGCACTGGCCGCATC
CGGCACCGTGCCGGCCGCGGCCCCGCAGCAGCCGGCCGCACCGCAGGGCGGCCTCTACAGCGACGCGTCG
CCGACCAACGTGCAGGACGCGTACAACGCGCTCAAGACGTACCTGATGCTGTCCGACAAGCGTCACGTCG
AGCAGGCGCACCTGACCGACCAGCTCGCCCGCTTCTGGCGCGGCTGGCTCGAGACGAATCGCGGCAACAT
GCCGCGTGACGAGATGATCAAGAGCGCGGAGCGCATGATCTCGTTCTACCTGTCCCGCGTGAACGACGAC
GACTGGCCGATGATCGACGCGAACCTCGCGCTCGTCGACCAGACCCGCGAGAACCTGCGCCACGTCGTGC
GCGGCATGCCGGCCCGCCAGCGCGTGTACGAGGAAATCAAGGCACGCGCGTCGACCCGCTTCGCGCCGAT
GACCATCGCGCGCATCGTCGGCGACGGCAACCAGGGGCTCGTGGCAGGCAGCTACGCGATTCCGGGCACG
TTCACGCGCGAAGCGTGGTTCGACTACGTGCAGCCGGCGATCCGCGACGCGGCGACCAAGGAACTGCAGG
CGAAGGACTGGGTGCTGAACACGTCGACGCAGGATGACCTGACGCTCGAGGGCAGCCCCGAGCAGATCCA
GAAGACGCTCGTCGGCATGTACAAGACCGAGTACGCGCAGCACTGGCAGAAGTTCATGCAGGGCATCGCG
GTGCAGGGCTTCAGCAGCTTCGGCCAGGCCGTCGACGGGATGAACCGCCTCGGCGACCCGCAGGATTCGC
CGATCCGCAAGATCCTCGAGACCGCGTACGACCAGACGTCGTGGGACAACCCGTCGCTCGCGAACGTGAC
GATCAAGAAGGCGCAGACGGGCGTCGTGAACTGGGTCAAGCAACTGTTCTCGCGCTCGCAGGCCGGCCAG
GTGGCGGCTGCCAACATCGACATCAACGGCAATCCGGCCGAGGTGCCGATGGGTCCGATCGGCCAGGAGT
TCATCGGGCTCGCGCGGATCGTCGCGACGCATGACGGCACGTCGATGCTCAAGGGCTACATGGATTCGCT
GTCGAAGGTCCGCACGCGCTTCAACGTGATCAAGAACCAGGGCGACCCGGGCCCGGGCGCGCGCCAGCTG
ATGCAGCAGACGCTCGACGGCAACGGCTCGGAACTCGCCGATTCGCTGAAGCTGGTCGACGAGCAGATGC
TGACGGGCCTCACCGATTCGCAACGCAAGTCGCTGCGTCCGCTGCTCGTGCGGCCGCTGATGCAGGCGTT
CGCGGTCGTGATCCAGCCGGCCAGCGCGGAAGTCAACAAGGTATGGAACGCGCAGGTCTACCAGCCGTTC
CAGAACTCGCTCGCGACGAAGTACCCGTTCGCGGCGAGCGCGAAGGTCGAGGCCGGCGCCGGTGAAATCG
CGCAGGTGTTCGGTCCGGACGGCTCGATCGCGAAGTTCGTCGGCACGACGCTCGGGCCGCTCGCGGTGCG
CCGCGGCGACACCCTCGCCGCCCGCACGTGGGGCGACATGGGCATCGGCCTCACGCCGGACTTCACCAGC
GGCTTCGCGCGCTGGGTCGCGCCGCTCGCCGGCGGTGCGGCAGGCAGCGCCGCCGCGTCGTCCGAGCCGC
AGACCGTGTTCCAGATCCTGCCGCAGCCGAGCACGGGCACGACGGAATACACGATCGCGATCGACGGCCA
GCAACTGCGCTACCGCAACACGCCGCCGCAGTGGACCAACTTCGTGTGGCCGAACCCGCAGGGTTCGCCG
GGCGCGACGCTGTCCGCGACGACCTTCGACGGCCGCACGGTGCAGCTCGTCAACGAGCCGGGCCGCTACG
GTCTCGAGAAGCTGATCAACTCCGCGCAACGCAAGCGCCGTCCGGACGGCACCTTCGACCTGACGTGGGC
GCAGGGCAGCGTGAACGTGTCGGTGACGATGCGCATCATCAGCACGTCGCAACCGTCCGGCGGTGGCGGT
GACCAGCCGCAGCAGCAGAGCCTGCGCGGCCTGCAGCTGCCGTCGTCGGTCGCCGACGCGAGCACGGGCG
CCGCGCAGAACGCGACCCAGTCCGCCGGCACGGGCACGCCGGCCGCAGCGCCGGCCGTCGCGGCCGCCAA
CGCAACGAATGCCCAGGGGGCGCAATGA
 Primer design