SecReT6
Protein ID: 78221497
SecReT6 ID107
T6SS typei1
Gene symbol-
Locus tagGmet_0274
StrainGeobacter metallireducens GS-15
Repliconchromosome [GenBank: NC_007517] [Browse all T6SS(s) in this replicon]
Location [Strand]303002..306466 [+]
Producthypothetical protein
NoteTssM
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.00E-63, Aligned region: 183..434
DUF1215 [PF06744], Evalue: 0.00011, Aligned region: 897..933
DUF1215 [PF06744], Evalue: 0.00011, Aligned region: 948..1000
Protein Sequence: 1154 a.a.     [Download]
>gi|78221497|ref|YP_383244.1| unnamed protein product [Geobacter metallireducens GS-15]
MKTKLVTFLKWFLVAGGAAVVVLLVFGIVLALDWPWWVALCILLLLAGIGVGIVLLRAMWLRKREQNFVQ
EVIARDKGLLKALSGKEREHLTQLQEQWKDAIGTLKNSHLKKQGNPLYVLPWYLVIGESGSGKTTSLNSA
RLSSPFIDVCRASGVSGTRNCDWWFFEESIVIDTAGRYAVPIDSEKDRDEWQKFLSLLVKYRKKEPLNGL
IVTVAADRLLAAGREENAEEGRTMRSRIDELMRALGVRFPIYVLVTKCDLVEGMNRFAGLLPEKALRQPM
GMVNQELATDVVTFTDKAVAAVVERLRTLRLLLLHQPEAREADPGLVLFPEEFAVLRDALAAFMEGAFRE
NPYQETPVMRGLFFSSGRQEGNPHSRFSEALGLSGEMAALPGTSKGLFLHDFFARILPADRALLAPTRRA
VEWRALTGNLGLVSWMLLGVALCGLLSFSFVKNMTTIRQVSHQFERTPRLAGNPTSDLLVLDAFRQGILK
VEERNRSWWIPRFGLTESVKVERTLKERFCRQFRDGFLTPYDRQLATGVAGLSAGTPDELFAQYAIHLTR
RINILNAGMNGKKLPELSAMPQPASVSFLAGETAAGADARKRFGTLYLHYLAWRADSPDLAKETAQLQGW
LRQIIGLKGGSLSWLAPWIDRQSGLPSVTMAEFWGGGAPLPGEAAVPPSFTRKGKGEMDSLVAELETALG
DPRLVAAGKGGLGSWYRGSCLAAWQRLAAAFPTGKERLRTVRDWQQTAARMATDQGPYFAFINRMSAELD
TLVGKEGVPPFVVQLYAFQVARAGGAVPGAVGKAAESGKRLINSLGERIHPDAAVAKGIETPLAAPKAWQ
EYQTALAAIAPAASSRQQAFQLATQTFGDDPATGKTPFMAAWGAAGRLRAGVAGAGADEAFWRLVTGPLD
YLWTYVRHEAGCQLQTLWEEQVIAATLGMPPQQAGPLLLGPDGLAWRFVKGPAAPFIRGTAAGYAPRQAL
GVALPIEGALFAFLSKGAQIQASAGGRQPNYTVAVKGLPTDANADARIRPHATRLELQCAGTPQTLVNQN
FPVGKTFYWSPETCGDVIFQIEVGDQVLTKRYGGPQAFPDFLREFAGGSRTFPAREFPGEKEALERMGIK
HIRVNYQIMGGGQVVKQGSAMAGATAPRVIARCW
 
Nucleotide Sequence: 3465 bp     [Download]
>gi|78221228|ref|NC_007517.1|:303002-306466 Geobacter metallireducens GS-15 chromosome, complete genome
ATGAAAACGAAGCTCGTGACCTTTCTCAAGTGGTTTCTCGTGGCGGGAGGGGCGGCAGTGGTCGTCCTTC
TCGTTTTTGGTATTGTGCTCGCCCTCGACTGGCCCTGGTGGGTGGCCCTCTGCATCCTCCTCCTTCTGGC
GGGGATCGGGGTCGGCATTGTGCTGCTGCGGGCCATGTGGCTGCGCAAGCGGGAGCAGAATTTCGTCCAG
GAGGTGATCGCCCGGGACAAGGGGCTCCTGAAGGCCCTTTCCGGCAAGGAGCGGGAGCACCTTACCCAGC
TCCAGGAGCAGTGGAAGGATGCCATCGGCACCCTGAAGAATTCCCATCTCAAGAAGCAGGGAAACCCCCT
TTACGTCCTCCCCTGGTACCTGGTGATCGGCGAGAGCGGCTCCGGGAAGACCACCTCCCTCAACAGCGCC
CGCCTGTCATCCCCTTTCATCGACGTCTGCCGGGCCTCCGGCGTTTCCGGCACCCGCAACTGCGACTGGT
GGTTCTTCGAGGAATCCATCGTCATCGACACGGCCGGTCGCTACGCGGTTCCCATCGACAGCGAGAAGGA
CCGGGACGAGTGGCAGAAGTTCCTGTCGCTCCTCGTCAAGTACCGGAAGAAAGAGCCCCTGAACGGCCTC
ATCGTCACCGTGGCGGCAGACCGGCTCCTGGCGGCGGGGCGCGAGGAGAACGCGGAGGAGGGGCGCACCA
TGCGGAGCCGCATCGACGAGTTGATGCGGGCCCTGGGGGTGCGGTTCCCGATCTATGTCCTCGTCACCAA
GTGCGATCTGGTTGAGGGGATGAACCGCTTTGCCGGGCTTCTGCCGGAAAAGGCCCTCCGGCAGCCCATG
GGGATGGTGAACCAGGAACTGGCCACGGACGTGGTCACCTTCACCGACAAGGCGGTTGCCGCCGTGGTGG
AACGGCTCCGGACCCTCCGGCTGCTGCTTCTCCACCAGCCCGAGGCCCGGGAAGCGGATCCGGGGCTCGT
CCTCTTTCCCGAGGAGTTCGCGGTCCTGCGGGATGCCCTCGCCGCCTTCATGGAGGGGGCCTTCCGGGAA
AACCCCTACCAGGAGACCCCGGTCATGCGGGGGCTCTTCTTCTCCAGCGGCCGCCAGGAGGGGAATCCCC
ATTCCCGCTTCTCCGAGGCCTTGGGCCTCTCGGGGGAAATGGCGGCGCTCCCCGGCACCAGCAAGGGTCT
CTTTCTCCACGACTTTTTCGCCAGGATTCTCCCCGCCGACCGGGCGCTCCTGGCGCCGACCCGCCGTGCC
GTGGAGTGGCGGGCCCTCACCGGGAACCTGGGGCTCGTCTCCTGGATGCTCCTGGGCGTGGCCCTCTGTG
GTCTCCTTTCCTTTTCCTTCGTGAAGAACATGACCACCATCCGCCAGGTCTCCCATCAGTTCGAGCGGAC
TCCGCGGCTGGCCGGCAACCCCACCAGCGATCTCCTAGTGCTCGACGCCTTCCGCCAGGGAATCCTGAAG
GTGGAGGAGCGGAACCGCTCCTGGTGGATTCCCCGTTTTGGCCTCACGGAGAGCGTCAAGGTGGAGCGGA
CCCTCAAGGAGAGGTTCTGCCGCCAGTTCCGGGACGGTTTCCTGACCCCCTACGACCGGCAGCTGGCCAC
CGGTGTCGCGGGCCTTTCCGCTGGCACCCCCGACGAGCTCTTCGCCCAGTACGCCATCCATCTGACCCGG
CGGATCAATATCCTCAACGCCGGCATGAACGGTAAAAAGCTGCCGGAACTGAGCGCCATGCCCCAGCCGG
CTTCGGTCTCCTTCCTGGCCGGCGAAACCGCCGCCGGTGCTGATGCCCGCAAGCGGTTCGGCACCCTCTA
CCTCCACTACCTGGCCTGGCGGGCAGATTCCCCCGATCTTGCCAAGGAGACGGCCCAGCTTCAGGGGTGG
CTCCGCCAGATCATAGGCCTCAAGGGGGGAAGCCTTTCCTGGCTTGCCCCGTGGATCGACCGGCAGTCGG
GGCTTCCGTCGGTGACCATGGCCGAATTCTGGGGAGGGGGCGCGCCGCTCCCGGGAGAGGCAGCGGTTCC
CCCCTCCTTTACCCGCAAGGGGAAGGGGGAGATGGACAGCCTCGTGGCCGAGCTGGAGACGGCCCTCGGC
GACCCGCGCCTCGTGGCGGCGGGCAAGGGCGGCCTTGGCTCCTGGTACCGGGGGAGTTGCCTGGCGGCGT
GGCAACGGCTTGCCGCGGCGTTCCCCACGGGAAAGGAGCGGCTCCGCACTGTCCGCGACTGGCAGCAGAC
GGCCGCCAGAATGGCCACAGACCAGGGGCCCTATTTCGCCTTCATCAACCGGATGTCCGCCGAGCTCGAT
ACCCTCGTGGGCAAGGAGGGGGTACCTCCCTTTGTGGTCCAGCTCTATGCCTTTCAGGTGGCCCGGGCGG
GGGGTGCGGTTCCGGGCGCCGTGGGGAAGGCCGCCGAGAGCGGCAAGCGTCTCATCAACTCCCTCGGCGA
GAGGATTCATCCCGATGCCGCCGTGGCCAAGGGGATCGAAACGCCCCTGGCGGCCCCGAAGGCCTGGCAG
GAGTACCAGACGGCCCTGGCGGCCATCGCGCCGGCGGCATCGTCGCGGCAGCAGGCCTTCCAATTGGCCA
CTCAGACCTTCGGCGACGACCCGGCCACCGGCAAGACCCCCTTTATGGCCGCCTGGGGCGCAGCCGGCCG
CCTTCGGGCCGGAGTTGCCGGCGCCGGAGCCGACGAAGCCTTCTGGCGGCTCGTGACCGGCCCCCTCGAC
TACCTCTGGACCTACGTCCGGCATGAGGCCGGCTGCCAGCTCCAGACCCTCTGGGAGGAGCAGGTGATCG
CCGCCACCCTCGGGATGCCCCCCCAGCAGGCGGGCCCCCTGCTCCTTGGCCCCGACGGCCTTGCCTGGCG
CTTCGTCAAGGGGCCCGCAGCTCCCTTCATCCGGGGGACCGCCGCCGGCTACGCGCCCCGGCAGGCCCTC
GGGGTGGCACTCCCCATCGAGGGGGCCCTCTTCGCCTTCCTCTCCAAGGGTGCCCAGATTCAGGCCTCGG
CTGGGGGGCGCCAGCCCAACTACACCGTGGCCGTCAAGGGGCTTCCCACCGACGCCAACGCCGATGCCCG
GATCAGGCCCCACGCCACCCGGCTGGAGCTCCAGTGCGCTGGCACCCCCCAGACCCTCGTGAACCAGAAC
TTCCCCGTAGGGAAGACCTTCTACTGGTCCCCCGAAACCTGCGGCGACGTCATCTTTCAGATCGAGGTGG
GTGACCAGGTTCTCACCAAACGTTACGGCGGTCCCCAGGCCTTCCCCGACTTCCTCCGGGAGTTTGCCGG
CGGTTCGCGCACTTTCCCGGCCCGGGAGTTCCCCGGCGAGAAGGAGGCCCTTGAGCGGATGGGGATCAAG
CATATCCGCGTCAACTACCAGATCATGGGGGGAGGGCAGGTGGTCAAACAGGGGAGCGCCATGGCCGGCG
CCACGGCCCCCCGGGTCATCGCCCGGTGCTGGTAA
 Primer design