SecReT6
Protein ID: 83646991
SecReT6 ID110
T6SS typeN/A
Gene symbol-
Locus tagHCH_04294
StrainHahella chejuensis KCTC 2396
Repliconchromosome [GenBank: NC_007645] [Browse all T6SS(s) in this replicon]
Location [Strand]4438269..4438757 [+]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDQ2SEC3
KEGG IDhch:HCH_04294
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.30E-32, Aligned region: 4..138
Protein Sequence: 162 a.a.     [Download]
>gi|83646991|ref|YP_435426.1| hemolysin-coregulated protein [Hahella chejuensis KCTC 2396]
MAIYMNYDGLKVKGNVTAEGYKDWIRLDSFQFGVGRHITMEAGHMSNREATRPSISEISVSKLMDTASSG
LFKESLTGTAGVKVLVDIVRTQADKIEKYVSYEMEDVMVSSYSVSAGAESAPAESISLSFSKVTMSYTAA
DKKHAGKTPERVGYDLEAGKKI
 
Nucleotide Sequence: 489 bp     [Download]
>gi|83642913|ref|NC_007645.1|:4438269-4438757 Hahella chejuensis KCTC 2396 chromosome, complete genome
ATGGCTATTTACATGAACTACGACGGTCTGAAAGTTAAAGGCAACGTGACTGCTGAAGGCTACAAAGACT
GGATTCGTCTGGACAGCTTCCAATTCGGCGTTGGTCGTCACATCACTATGGAAGCCGGCCACATGTCCAA
CCGCGAAGCTACTCGTCCCAGCATCAGCGAAATCTCCGTTTCCAAACTGATGGACACCGCTTCTTCCGGT
CTGTTCAAAGAGTCTCTGACTGGTACTGCTGGCGTTAAAGTTCTGGTTGATATCGTTCGTACTCAAGCCG
ACAAAATCGAGAAGTACGTTTCCTACGAGATGGAAGACGTAATGGTAAGCAGCTACAGCGTTTCCGCTGG
CGCTGAGTCCGCTCCGGCTGAGTCTATCTCCCTGAGCTTCTCCAAAGTAACTATGTCTTACACTGCTGCT
GACAAGAAGCACGCTGGCAAGACTCCAGAGCGCGTTGGTTACGACCTGGAAGCTGGCAAAAAGATCTAA
 Primer design