SecReT6
Protein ID: 83646995
SecReT6 ID110
T6SS typeN/A
Gene symbol-
Locus tagHCH_04298
StrainHahella chejuensis KCTC 2396
Repliconchromosome [GenBank: NC_007645] [Browse all T6SS(s) in this replicon]
Location [Strand]4440744..4444202 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ2SEB9
KEGG IDhch:HCH_04298
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.90E-94, Aligned region: 190..452
IcmF-related [PF06761], Evalue: 1.80E-70, Aligned region: 501..798
DUF1215 [PF06744], Evalue: 6.30E-33, Aligned region: 894..1014
AAA_22 [PF13401], Evalue: 0.00026, Aligned region: 128..144
AAA_22 [PF13401], Evalue: 0.00026, Aligned region: 408..486
AAA_22 [PF13401], Evalue: 0.00026, Aligned region: 591..615
MMR_HSR1 [PF01926], Evalue: 0.00067, Aligned region: 128..229
MMR_HSR1 [PF01926], Evalue: 0.00067, Aligned region: 408..446
AAA_16 [PF13191], Evalue: 0.0023, Aligned region: 125..251
AAA_16 [PF13191], Evalue: 0.0023, Aligned region: 408..438
AAA_16 [PF13191], Evalue: 0.0023, Aligned region: 530..561
AAA_16 [PF13191], Evalue: 0.0023, Aligned region: 828..861
AAA_17 [PF13207], Evalue: 0.0033, Aligned region: 128..140
AAA_17 [PF13207], Evalue: 0.0033, Aligned region: 407..422
AAA_17 [PF13207], Evalue: 0.0033, Aligned region: 583..642
AAA_19 [PF13245], Evalue: 0.0037, Aligned region: 127..144
AAA_19 [PF13245], Evalue: 0.0037, Aligned region: 408..416
AAA_19 [PF13245], Evalue: 0.0037, Aligned region: 809..831
AAA_33 [PF13671], Evalue: 0.0039, Aligned region: 128..140
AAA_33 [PF13671], Evalue: 0.0039, Aligned region: 243..266
AAA_33 [PF13671], Evalue: 0.0039, Aligned region: 408..422
AAA_33 [PF13671], Evalue: 0.0039, Aligned region: 772..798
AAA_10 [PF12846], Evalue: 0.0052, Aligned region: 128..144
AAA_10 [PF12846], Evalue: 0.0052, Aligned region: 408..577
AAA_10 [PF12846], Evalue: 0.0052, Aligned region: 814..860
Protein Sequence: 1152 a.a.     [Download]
>gi|83646995|ref|YP_435430.1| hypothetical protein HCH_04298 [Hahella chejuensis KCTC 2396]
MSRFFKWMIDPRFLTIVGLIALSLVIWFGADYVRFGEKAEPASGAVRLVVILCVWFVATIIFLIKMLGQR
KQNNSMVEAIQEEAKPSASDEEARVVGERFREAMSLLRTAKFDTKAGRRSVYQLPWYIIIGPPGAGKTTA
LINSGLHFPLKEKLGLQQIGGVGGTRNCDWWFTDEAVLIDTAGRYTTQDSDAAQDRTGWRNFLALLKKHR
MRRPINGVLLAVSVQDLLSSSEAERMQHAELIRNRIQELAENFQVRFPIYFLFTKADLISGFNEFFENLG
ATEREKVWGMTFPNTEDQNASQTAEYFAPEFEALVKRLNERVIWRAHQERDTRRRSKILAFPGQVENMRS
VLDSFIKSVFKTSRFEKQSLLRGVYFTSGTQEGRPIDRILANLSSNYGINYNVAANAPGAGKSFFLNKLL
KEVVFPEAEIATLNTRYEGHIKWSRRVAFITLLLAFGGALAAWTSSVVSTQNMMADIQELLNKHNQLASA
TPEPNEFEQVLDILKPLEDAQQLYSEVDHPWLSNLGLYDSGVVAETENTFDASLRHFLTPLLRQRLEGVL
VTEDNNDAIYEALRVYLMMGNSRVRDNNEIKTWFARYWEEKLPGKASEQNALKTHLNQVLDSNFTDLSLK
DTVVERSREKLRTIPIERRIYQQIKRQPEFAGFLNLRDDLGVDFAGTFVVDSQVSSDLKIPRLYTKAGYG
KLDLSPDSNLVKRYSSEQWILGAQVEEDFSEKDVENIVEKIKHLYFTDYIDVWSRALNSPKVVDFGSMDV
ARNKLANNLDRTQSPILTLLTRASKETLLTPPLPDANVSGRTGQALDAAANLVAQQREPTPVDDAFKSLH
RLMEDKEIDRYWEKLRGIFDKLEETSLAPNSSEAAFKFALARFSGGEDPVKALRVTASRAPSYLKGWLES
MGDQSWKVLLGAGGSHLSAAWNREVYSVYQKTLAKNYPFSSRSSSDASLSDFAAFFKPGGIEDSFVKANV
APFITSSWRAKGVDGRGIGISSQALQQMQVADSIRRVFFGDKGEDPHVRFQVKPHKLDNTVRRFDFEVGS
QRLRYTHGPQLKMSMDWPADKSGARVVFEDLNETLHTDAYEGDWGLFRLLDAHKVSKGSSSRLYNVMISV
DHRNGEMELFASSTVNPFTPGWIKRYDCPSSL
 
Nucleotide Sequence: 3459 bp     [Download]
>gi|83642913|ref|NC_007645.1|:c4444202-4440744 Hahella chejuensis KCTC 2396 chromosome, complete genome
ATGTCCCGCTTTTTTAAATGGATGATTGACCCACGGTTTTTGACGATAGTGGGACTTATAGCGCTTTCTC
TGGTGATATGGTTCGGGGCCGATTACGTCCGCTTCGGAGAAAAAGCAGAGCCCGCTTCCGGGGCGGTCAG
ACTGGTCGTCATACTCTGTGTCTGGTTTGTCGCCACCATTATCTTCTTGATAAAAATGCTGGGGCAACGC
AAGCAGAACAACTCCATGGTGGAGGCGATTCAAGAAGAAGCCAAGCCTTCCGCATCTGATGAGGAAGCGA
GAGTTGTCGGCGAGCGTTTCCGTGAGGCGATGAGTCTGCTGCGCACCGCGAAGTTCGACACCAAGGCGGG
GCGACGTTCTGTCTACCAGTTACCCTGGTATATCATCATTGGGCCGCCGGGCGCAGGTAAGACGACTGCG
CTGATTAATTCCGGCCTGCACTTTCCATTGAAAGAAAAGCTGGGGCTGCAGCAAATTGGCGGCGTTGGCG
GTACCCGTAACTGCGATTGGTGGTTTACGGATGAAGCGGTATTGATCGATACGGCCGGTCGTTACACCAC
CCAGGACAGCGACGCCGCCCAGGACCGCACGGGCTGGCGTAATTTCCTTGCGCTGCTGAAAAAACATCGT
ATGCGCAGACCGATCAACGGCGTCCTTCTGGCGGTGAGCGTTCAGGATTTACTGAGCTCCAGCGAAGCCG
AGCGTATGCAGCATGCTGAGCTCATTCGCAATCGAATTCAGGAACTGGCTGAGAATTTTCAGGTTCGCTT
CCCTATTTATTTCCTCTTCACGAAAGCGGATCTTATTTCCGGCTTTAATGAGTTCTTTGAAAATCTCGGC
GCCACTGAGCGTGAAAAAGTCTGGGGGATGACTTTCCCTAATACAGAGGATCAGAATGCGTCTCAGACGG
CGGAGTACTTTGCTCCCGAGTTTGAAGCATTGGTCAAGCGATTGAATGAGAGAGTGATTTGGCGGGCGCA
TCAAGAGCGAGACACCCGCCGCCGTTCTAAGATTCTCGCTTTCCCAGGGCAAGTGGAAAACATGCGCTCA
GTCCTGGATAGCTTTATCAAGTCCGTTTTCAAAACCAGTCGTTTCGAAAAACAGTCGCTGCTCCGCGGCG
TATATTTCACCAGTGGCACCCAGGAAGGCCGTCCGATCGACCGGATTCTGGCGAACCTGTCTTCCAACTA
TGGCATCAACTATAACGTTGCCGCCAATGCGCCGGGCGCAGGTAAAAGTTTCTTCCTGAACAAGTTGTTG
AAAGAGGTTGTTTTCCCTGAGGCGGAAATCGCTACGCTTAATACCCGCTACGAAGGCCATATAAAGTGGT
CGCGTCGCGTCGCTTTCATCACCCTCCTACTCGCCTTTGGCGGCGCACTTGCCGCGTGGACTTCAAGTGT
GGTGAGTACACAGAACATGATGGCGGATATTCAGGAACTGTTGAACAAGCACAATCAGTTGGCGTCAGCA
ACTCCTGAGCCGAATGAATTCGAGCAGGTGCTGGATATTTTGAAGCCATTGGAAGACGCTCAGCAGCTCT
ATTCGGAAGTGGATCACCCTTGGCTGAGCAATTTGGGGCTGTATGATTCCGGCGTTGTTGCAGAAACTGA
AAATACTTTTGACGCCTCCTTACGTCATTTCCTGACGCCATTGTTGCGCCAGAGATTGGAAGGCGTGTTG
GTTACGGAAGACAACAATGACGCCATATATGAAGCGCTGCGCGTTTATCTGATGATGGGGAACAGCCGGG
TTCGCGATAATAATGAAATCAAGACCTGGTTTGCGCGTTATTGGGAGGAGAAGCTTCCCGGCAAGGCTTC
TGAGCAGAACGCGCTGAAAACACATCTGAACCAAGTGCTGGACAGCAACTTTACGGATTTGTCTCTGAAG
GATACGGTTGTTGAGCGTAGCCGGGAGAAGCTGAGAACTATCCCGATCGAGAGACGTATTTATCAGCAGA
TCAAGCGCCAGCCTGAATTCGCAGGTTTCCTGAATTTGCGCGACGACTTGGGCGTGGACTTTGCGGGTAC
GTTTGTAGTGGATTCGCAAGTCAGCTCGGACCTGAAGATTCCGCGTCTGTACACTAAAGCAGGATACGGC
AAGCTGGACCTCTCTCCCGATTCTAATCTGGTGAAGCGTTACTCAAGCGAACAATGGATTCTTGGCGCAC
AAGTGGAAGAAGACTTCTCTGAAAAGGATGTTGAGAACATTGTAGAGAAGATCAAGCATCTCTATTTCAC
CGATTATATTGACGTTTGGAGCCGGGCGCTGAACTCTCCCAAAGTGGTCGACTTCGGCTCTATGGATGTG
GCGCGCAACAAGCTGGCCAACAACCTGGATCGTACTCAGTCTCCAATATTGACTCTGTTGACTCGCGCCA
GCAAAGAAACGTTGCTAACGCCACCGCTTCCTGACGCAAATGTCAGTGGACGCACAGGCCAGGCTTTGGA
TGCGGCCGCTAATCTGGTGGCGCAGCAGCGTGAGCCTACGCCCGTGGATGATGCTTTCAAGTCGCTGCAT
AGGTTGATGGAAGATAAAGAAATTGACCGCTATTGGGAAAAACTGCGCGGCATATTCGACAAATTGGAAG
AGACATCTCTTGCACCAAACTCATCTGAGGCTGCTTTCAAGTTCGCACTGGCCCGTTTCAGTGGCGGTGA
AGACCCTGTCAAAGCATTGCGTGTCACGGCATCAAGAGCGCCAAGCTATCTGAAAGGATGGTTGGAGTCG
ATGGGCGATCAAAGCTGGAAAGTGCTGTTGGGCGCAGGTGGTTCGCACTTGAGCGCGGCCTGGAATAGAG
AAGTGTACTCTGTCTACCAGAAGACGTTGGCTAAAAACTACCCATTCTCTTCCAGATCATCCAGTGACGC
TTCCCTGAGCGACTTTGCGGCGTTCTTTAAACCTGGCGGCATTGAAGACAGTTTCGTCAAGGCGAACGTC
GCGCCATTCATCACTTCATCCTGGCGCGCCAAGGGCGTGGATGGTCGTGGTATTGGCATCAGCAGTCAAG
CCTTGCAACAGATGCAGGTGGCTGACTCTATCCGCCGTGTATTCTTTGGCGACAAAGGTGAAGACCCGCA
CGTTCGTTTCCAGGTAAAACCGCATAAACTTGATAACACCGTCCGTCGTTTCGACTTCGAGGTGGGTAGT
CAGCGGTTGCGATACACTCATGGTCCTCAGTTGAAAATGAGCATGGACTGGCCGGCGGACAAGAGTGGCG
CGAGAGTCGTCTTCGAGGACCTGAACGAAACTTTGCACACTGACGCCTATGAAGGAGATTGGGGACTGTT
CCGATTATTGGACGCTCATAAGGTGAGCAAAGGGAGTTCTTCCCGTTTATACAACGTGATGATCAGTGTT
GACCATCGCAATGGAGAAATGGAGCTTTTCGCCAGCAGTACGGTTAACCCCTTCACACCGGGATGGATAA
AGCGGTACGACTGTCCGAGCAGCTTATAG
 Primer design