SecReT6
Protein ID: 83646996
SecReT6 ID110
T6SS typeN/A
Gene symbol-
Locus tagHCH_04299
StrainHahella chejuensis KCTC 2396
Repliconchromosome [GenBank: NC_007645] [Browse all T6SS(s) in this replicon]
Location [Strand]4444288..4445169 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ2SEB8
KEGG IDhch:HCH_04299
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-70, Aligned region: 68..273
Protein Sequence: 293 a.a.     [Download]
>gi|83646996|ref|YP_435431.1| hypothetical protein HCH_04299 [Hahella chejuensis KCTC 2396]
MSNDSDKTFFGGAGGSDRTVIVPTPGGRSSGGLSTQPPPTAFAPHQAPTPPPSAVDGGQGLDVKQGLNPL
TASASELIALLGELRQTVQVQNPNQLRQQVIQQIRRFESEAQSKGVASDVVLSARYVLCSALDEAIMNTP
WGAEVGWSRATLLSTFHRENVGGEKVFLILDKILATPAKYIDLIELIYVCLSLGFEGKYKLDPRGRDYLE
TIRDNLVRTIQMQRGEFDGDLSPRWRGATPAKKRISEYVPLWVVASIMAAGLLLSYSGFRYWLGTVTDAQ
EQQLQELTQKYQS
 
Nucleotide Sequence: 882 bp     [Download]
>gi|83642913|ref|NC_007645.1|:c4445169-4444288 Hahella chejuensis KCTC 2396 chromosome, complete genome
ATGAGCAACGATTCTGATAAAACATTTTTCGGCGGCGCTGGCGGCAGTGATCGTACAGTCATTGTACCCA
CACCCGGGGGCCGCTCTTCTGGCGGCCTGTCGACACAGCCTCCGCCGACGGCTTTTGCGCCCCATCAGGC
GCCAACTCCTCCTCCTAGCGCCGTTGACGGCGGACAGGGTTTGGATGTTAAGCAGGGGTTAAACCCTCTT
ACCGCCAGCGCCTCGGAGCTGATCGCATTACTGGGAGAGTTGCGTCAGACCGTGCAGGTGCAAAACCCGA
ATCAGCTGCGCCAGCAGGTTATCCAACAGATTCGCCGTTTTGAGTCCGAAGCGCAGTCAAAAGGGGTGGC
CTCTGATGTCGTGCTATCGGCTCGCTATGTTTTGTGCTCGGCGCTGGACGAAGCGATCATGAACACCCCC
TGGGGTGCGGAGGTCGGCTGGTCGCGAGCGACGCTTCTCAGCACGTTTCACCGTGAGAACGTGGGCGGTG
AGAAAGTCTTCCTGATTTTGGACAAGATACTGGCGACCCCGGCCAAGTATATCGACCTCATTGAGCTGAT
ATACGTGTGTCTGAGCCTGGGCTTTGAGGGGAAATATAAGCTGGACCCTCGTGGCAGGGATTATCTGGAG
ACCATTCGCGACAACTTGGTGCGTACAATTCAGATGCAGCGAGGCGAGTTTGACGGGGATCTGTCTCCTC
GTTGGCGTGGCGCCACTCCAGCTAAAAAGCGTATTTCGGAGTACGTGCCGCTGTGGGTTGTCGCGTCCAT
CATGGCCGCGGGACTGTTACTGAGTTATAGCGGCTTCCGCTATTGGCTGGGTACGGTGACCGACGCGCAG
GAACAGCAGCTTCAGGAACTGACGCAGAAGTATCAGTCTTAA
 Primer design