SecReT6
Protein ID: 83646997
SecReT6 ID110
T6SS typeN/A
Gene symbol-
Locus tagHCH_04300
StrainHahella chejuensis KCTC 2396
Repliconchromosome [GenBank: NC_007645] [Browse all T6SS(s) in this replicon]
Location [Strand]4445274..4446611 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ2SEB7
KEGG IDhch:HCH_04300
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.50E-155, Aligned region: 19..444
Protein Sequence: 445 a.a.     [Download]
>gi|83646997|ref|YP_435432.1| hypothetical protein HCH_04300 [Hahella chejuensis KCTC 2396]
MSFENRVVWTEGMFLRPQHFQQQDRYHESLLEARCKPLKAFFWGFYDLEIDSQVLKLGKFSINRCRGIFP
DGTPFNVPDIDSELDILEPEKGLQNQTVYLGIPVKRPGSPDTHLEEDNQTLVRFNARELETFDSTSEHSD
SSKIQIGQLRFRILLEREDRSGYAVLPIARIQDKRDDGEIVLDSQFIPPMLDVRAHPRMANLLQEVAGSL
NLRAEALAGRLRDSGRQGTSEIADFLMLQMINRVEPWLLHLAQIRPLHPVDVFGELMQIAGELATFTSVQ
RRPPATMPAYHHDELEKSIPQLMQILNQYMNTVSETSAVSLDLVERRYGIYVSPITDRSLVEKATYILAV
KAQMKSDQIRSRFPSQVKIAPVERIRDLINAALPGIGLQALPVAPRQIPFHTGFTYFQLDRNSDYWRALA
QSSGFAVHIGADFPGLEMEFWAIRD
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|83642913|ref|NC_007645.1|:c4446611-4445274 Hahella chejuensis KCTC 2396 chromosome, complete genome
ATGTCATTTGAAAACCGCGTCGTATGGACGGAGGGCATGTTCCTTCGTCCGCAGCACTTTCAGCAACAGG
ACCGCTATCATGAGTCATTGCTCGAAGCCCGCTGCAAGCCTCTAAAGGCATTTTTTTGGGGATTTTATGA
TCTGGAGATCGACAGCCAGGTGTTGAAGCTTGGAAAGTTCTCCATCAATCGCTGCAGAGGTATTTTTCCC
GATGGCACGCCGTTCAACGTTCCGGATATAGATTCTGAGCTTGATATTCTGGAGCCCGAGAAAGGGCTGC
AGAATCAAACGGTTTATCTAGGTATTCCTGTTAAGCGTCCAGGGTCGCCCGACACGCATCTGGAAGAGGA
CAATCAGACACTGGTGCGCTTTAACGCCCGTGAGCTGGAAACCTTTGACTCCACCTCCGAACATAGCGAC
AGTTCCAAAATACAGATTGGGCAACTACGTTTTCGTATCCTGCTGGAAAGAGAAGATCGCAGTGGTTACG
CTGTATTGCCCATCGCGCGGATACAGGACAAACGGGATGATGGAGAAATAGTTCTCGATTCTCAGTTTAT
CCCGCCCATGCTGGATGTAAGAGCGCATCCTCGCATGGCCAACCTGTTGCAGGAAGTGGCCGGCAGCTTG
AATTTACGCGCGGAAGCATTGGCGGGCCGATTGAGAGACAGCGGCAGACAGGGCACTTCCGAGATCGCAG
ACTTCCTGATGCTGCAGATGATTAACCGGGTTGAGCCCTGGTTGTTGCATTTGGCGCAAATCCGCCCGCT
ACATCCTGTAGACGTATTCGGCGAGCTAATGCAGATAGCTGGCGAATTGGCGACGTTCACCAGCGTTCAG
CGCCGGCCTCCCGCGACCATGCCGGCGTATCACCATGACGAGCTGGAAAAATCTATCCCACAGTTGATGC
AGATTCTGAATCAGTACATGAATACGGTAAGCGAGACCTCCGCCGTATCCTTGGATCTGGTTGAGCGTCG
CTATGGTATTTATGTTTCTCCAATTACGGACCGGTCATTGGTGGAGAAGGCGACTTACATATTGGCGGTC
AAGGCCCAGATGAAGTCGGATCAGATCCGCAGCCGTTTCCCAAGCCAAGTGAAAATCGCGCCGGTCGAAC
GTATTCGCGACTTGATCAATGCGGCGTTGCCTGGCATCGGGCTGCAAGCCCTGCCTGTGGCGCCGAGACA
AATTCCATTCCATACCGGTTTCACCTACTTCCAGTTGGATCGCAATAGCGACTACTGGCGAGCCTTGGCG
CAATCCAGCGGTTTTGCCGTGCATATCGGCGCGGATTTCCCAGGTTTGGAAATGGAGTTTTGGGCAATCA
GGGATTAA
 Primer design