SecReT6
Protein ID: 83646998
SecReT6 ID110
T6SS typeN/A
Gene symbol-
Locus tagHCH_04301
StrainHahella chejuensis KCTC 2396
Repliconchromosome [GenBank: NC_007645] [Browse all T6SS(s) in this replicon]
Location [Strand]4446626..4447105 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ2SEB6
KEGG IDhch:HCH_04301
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.10E-34, Aligned region: 18..154
Protein Sequence: 159 a.a.     [Download]
>gi|83646998|ref|YP_435433.1| hypothetical protein HCH_04301 [Hahella chejuensis KCTC 2396]
MRCQASFKNWAMLLLLALTVAGCTTVGKWTGRETTVTLRIHGANDVNPNEDGRASPVILNIFELENDRQF
DQEEFIALFQSAKEVLGRDLVKTYKLKELTPGELREETFTFDKRTHYIGVMAEYIRYDDASTKVVFQIDQ
NTSNKLDLFVDRLGMRIKD
 
Nucleotide Sequence: 480 bp     [Download]
>gi|83642913|ref|NC_007645.1|:c4447105-4446626 Hahella chejuensis KCTC 2396 chromosome, complete genome
ATGAGATGCCAGGCTTCTTTCAAAAATTGGGCTATGTTGTTGCTCTTGGCCTTGACGGTGGCCGGGTGTA
CGACTGTAGGCAAATGGACCGGACGGGAAACCACCGTCACTTTGAGGATTCACGGCGCCAATGACGTCAA
TCCTAACGAAGATGGGCGGGCTTCCCCTGTCATTCTGAATATATTCGAACTGGAAAATGATCGTCAGTTT
GATCAGGAAGAATTCATCGCCCTGTTCCAGAGCGCCAAAGAAGTATTGGGCCGCGATCTGGTGAAAACGT
ATAAATTGAAAGAGTTAACCCCGGGCGAGTTGCGGGAAGAGACCTTCACCTTCGATAAACGCACTCATTA
TATCGGCGTCATGGCGGAATATATCCGTTACGACGACGCTTCCACCAAAGTGGTCTTCCAGATCGATCAG
AACACCAGCAACAAACTGGATCTGTTCGTTGACCGCCTTGGCATGCGCATCAAGGATTAA
 Primer design