SecReT6
Protein ID: 83646999
SecReT6 ID110
T6SS typeN/A
Gene symbol-
Locus tagHCH_04302
StrainHahella chejuensis KCTC 2396
Repliconchromosome [GenBank: NC_007645] [Browse all T6SS(s) in this replicon]
Location [Strand]4447332..4449218 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDQ2SEB5
KEGG IDhch:HCH_04302
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.50E-15, Aligned region: 29..97
Protein Sequence: 628 a.a.     [Download]
>gi|83646999|ref|YP_435434.1| FHA domain-containing protein [Hahella chejuensis KCTC 2396]
MQVKLRVVQCPPESEMAGKIVTVEEDGATIGRANSNTWVLPDPNRYVSSVHAKIQFNGTGFEIVDQSTNG
TFLNNLSQALVKGQPTPINQGDQILLGPFVLLVEGDKPQDDGESTSITSDIDDIPGGAGAAASPGLDDLD
KWLTGVGSEPEPKPSVGALKGELIGGDTGLTGGDSSVDPLVAIGGSQKSSLYDEGLGLGVSGDEPPADNL
LGDSFGLGGGSAESGRMDIPSIPEDWDKSLIQPRKPEIPSTPKAPAPPVESKPKPRREPPPKSNPDSLLD
IVNTHPEQLAGLNQPHQLPKEIEPIQDLTGAGISNSDALESTSPSESSLWGQQPPPVEPSVKEPSGGDGS
LTDILNDMAPTGEPKPSEKPVEPKPEPDSPIANMGAQAPGKVVPPRRQVEQRPVKRETPPVKQPAMETPR
EAERAPVSTPPIQVSPEQAAGLAQALGLSRLTAEQQANLTPVIADMVRETVDGLMKALRARQTIKNEFRM
NLTMIQAAENNPLKFSVSAEDALDNLFTKSGRAYLSPMEATKEAFADISDHQLALFNGIRAAYDYLMSQF
NPEKLERRFEKQRGKSLFGGAGKNWEAYKDFFEEMNEDAEKTFKRLFGETFAESYERSFNELKANRQK
 
Nucleotide Sequence: 1887 bp     [Download]
>gi|83642913|ref|NC_007645.1|:c4449218-4447332 Hahella chejuensis KCTC 2396 chromosome, complete genome
ATGCAGGTAAAGCTTAGAGTCGTTCAATGTCCGCCTGAGAGCGAGATGGCGGGCAAAATCGTAACGGTTG
AAGAAGATGGGGCGACGATAGGTCGCGCCAATTCGAATACGTGGGTGCTGCCGGACCCTAACCGATACGT
ATCATCCGTTCACGCGAAGATTCAATTTAACGGAACAGGCTTTGAAATTGTTGATCAAAGCACCAACGGC
ACATTTCTAAACAATCTGAGTCAGGCTTTGGTAAAAGGCCAGCCAACCCCTATCAACCAGGGCGACCAGA
TTTTGCTCGGGCCGTTCGTATTATTGGTGGAAGGGGATAAGCCGCAGGATGACGGCGAATCAACGTCTAT
TACCTCCGACATTGATGACATTCCAGGCGGCGCAGGCGCTGCAGCTTCCCCGGGTTTGGATGATTTGGAC
AAGTGGCTGACTGGCGTTGGATCGGAGCCGGAGCCCAAACCTTCTGTGGGCGCACTGAAAGGCGAGCTCA
TTGGCGGCGATACGGGGTTAACTGGCGGCGACTCTTCTGTCGATCCTTTGGTCGCGATTGGCGGATCGCA
AAAATCGTCTCTGTATGATGAAGGCCTGGGATTGGGGGTGTCTGGAGACGAGCCCCCCGCAGACAATCTA
TTGGGTGATTCTTTTGGGCTCGGCGGCGGCTCTGCTGAGAGTGGCCGCATGGATATCCCCAGTATCCCTG
AAGACTGGGATAAGTCCCTTATTCAGCCGCGCAAGCCGGAAATCCCGTCTACGCCGAAAGCGCCTGCGCC
TCCCGTTGAGTCTAAGCCGAAGCCGCGTAGAGAACCCCCGCCTAAATCCAATCCGGATTCATTGCTGGAT
ATCGTGAACACTCACCCCGAACAGTTGGCGGGATTGAATCAGCCGCACCAGCTTCCTAAAGAGATTGAAC
CGATACAGGACCTGACTGGCGCAGGGATTAGTAATTCTGATGCGTTGGAATCCACTTCTCCGTCGGAGTC
CTCTTTGTGGGGACAGCAGCCCCCTCCTGTTGAACCTTCCGTTAAGGAACCTTCTGGCGGTGACGGCTCG
CTCACGGACATATTGAATGATATGGCTCCGACCGGTGAACCAAAGCCTAGTGAAAAGCCTGTCGAACCGA
AGCCCGAGCCGGATTCGCCGATTGCAAACATGGGCGCGCAAGCGCCGGGGAAAGTCGTGCCGCCCAGACG
GCAGGTCGAGCAGCGCCCGGTCAAACGAGAGACGCCTCCTGTGAAGCAGCCTGCTATGGAGACGCCTCGG
GAAGCCGAGCGTGCGCCTGTTTCCACGCCGCCGATTCAGGTTTCTCCAGAGCAGGCCGCCGGACTGGCGC
AGGCTTTGGGCTTGTCGCGTTTAACTGCGGAGCAGCAGGCCAATCTGACCCCCGTTATCGCCGATATGGT
GCGGGAAACAGTTGATGGTTTGATGAAGGCGCTGAGAGCCCGACAGACAATCAAAAATGAGTTTCGTATG
AATCTCACCATGATTCAGGCGGCTGAAAATAACCCGCTGAAATTCTCAGTGTCGGCGGAAGATGCATTGG
ACAACTTGTTTACGAAATCCGGGCGCGCCTATCTGTCGCCGATGGAGGCGACAAAGGAAGCCTTTGCCGA
TATTTCTGATCACCAGTTAGCGCTCTTTAATGGCATTCGGGCAGCATACGACTATCTTATGAGTCAGTTT
AATCCCGAAAAGCTGGAGCGTCGCTTTGAAAAACAGCGTGGAAAATCGTTATTTGGCGGCGCAGGTAAAA
ACTGGGAGGCCTACAAGGACTTCTTCGAAGAGATGAACGAGGACGCGGAAAAAACCTTCAAGCGTCTATT
CGGTGAAACCTTCGCGGAAAGTTATGAGCGTAGTTTCAATGAGTTGAAGGCAAATCGTCAGAAATGA
 Primer design