SecReT6
Protein ID: 83716079
SecReT6 ID113
T6SS typei1
Gene symbol-
Locus tagBTH_II0855
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]997685..1001575 [-]
Productlipoprotein
NoteTssM
UniProt IDQ2T6Z7
KEGG IDbte:BTH_II0855
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.00E-48, Aligned region: 177..421
ImcF-related_N [PF14331], Evalue: 4.00E-48, Aligned region: 1037..1061
Protein Sequence: 1296 a.a.     [Download]
>gi|83716079|ref|YP_439052.1| unnamed protein product [Burkholderia thailandensis E264]
MKTLCSMLARIAALIALAALSWATALYFDWPWWGAPAVFCAALAVWPLFGVARRALRAVRARAQLARLDG
AKRLPADRDAPLRRVVARWRAALDALERAAPAPGLRGRPRDALPWYLVIGRAGAGKTTALARARIASPLR
RARHDASLAPTEDCDWWCFDDAVVLDLAGRFAEPDATDDDRRAWGALLEQLGRARARRGINGVVVAIDAP
RLVTADRDALTIDGCAVRERLEQLIRLFDRRFPVYVLVTQCDRLYGFDEWAAQLAPEQRERAFGYLGDHD
ADAFVAHALEHVDARLAALRIALAARGEPPSPRALMLPHELARLRPALEALARAAFGPNVYQETPYLRGL
LFSSGRQAGGAPSLTLPDWLDAAPARTPGDAGLFLHDVFARVLPGERDASRPVERPSRSRLTPRRLALAA
WLFACVAAGLLMSASFVGDIRTVELIRRDYPAHPRFTGELAHDAATLARIARVIADVERCDERRLVRRLA
RPIADATPVGRLEAQLKRRYIAHYRRAIEPAADRLLFGEPDGASGARAADDGDIAVRIRNLVRYVNLMQA
RRRGADRETLARMPAPALARARDGGGASRADGARSAGGMSDTGDSGDTSDRTGRLSALIGALAVDRIAWS
APDDATLAARIAAAQAQLERLAYRDPDGAWLLALPDASAPRDVTLADFWPAAAPRTPPPEPRDARVPAAL
TAAHRPAIDAFLDEMAQAVANRPKFAFHRDAFDTWYRARRIDAWRDFVARFPQGEQGLATQAQWRAVIDT
IADRRDPFAALLARVDREFESVRDDALPPWLRFVRTASRMLAPARVPAASGGLGAALGSISRSGGRALRE
ALGGAPEQGRRTLERDAALRDALVDYERRVAALAADALAGPGAAYRLAADFHGFGVDPSVEASAMRAADD
ALRDVKRLAGERDVGGDVVWSLVGGPLHAVIAYVERQASCALQEDWERDVLWPLRRAATREDADDRLYGP
QGAFWAFVDGPAKPFVRVGAARASAVDTLGYRLPFTDAFLPLVDDAAARRVAQARRADEQRARQQAAAEL
DERIASLGKQIDAIRAQTVRIEIVAQPTDVNPEARARPFETVLTLQCAPQARTLANYNLRVSERIDWQPD
QCGDATLRIALGGVTLTRRYAGPLGIARFVQDFRYGVRRFTPGDFPDAKAQLERLGVRHVDVRYDFSGHD
ALLAHVERIDALERARRDDIARQRRIASRQDDGASDSGAAAIARAGGFAANPANPANTARAPSASSRSSP
SPAPGASAPSGTPDAGLPRRIGACWGDPARDGGMRP
 
Nucleotide Sequence: 3891 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c1001575-997685 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGAAGACGCTTTGCTCGATGCTCGCGCGGATCGCCGCGCTGATCGCGCTCGCCGCGCTCAGTTGGGCGA
CCGCGCTCTATTTCGACTGGCCGTGGTGGGGCGCGCCCGCCGTGTTCTGCGCGGCGCTCGCCGTTTGGCC
GCTGTTTGGCGTCGCGCGACGCGCGCTGCGCGCCGTTCGCGCGCGCGCGCAGCTCGCGAGGCTCGACGGA
GCCAAGCGCCTGCCCGCCGATCGCGACGCGCCGCTGCGGCGCGTCGTCGCGCGCTGGCGCGCGGCGCTCG
ATGCGCTCGAACGCGCCGCGCCCGCGCCGGGCCTGCGCGGCCGGCCGCGCGACGCGCTGCCCTGGTATCT
CGTGATCGGCCGCGCGGGCGCGGGCAAGACGACGGCGCTCGCGCGCGCGCGCATCGCGTCGCCGCTGCGG
CGCGCGCGCCACGACGCGAGCCTCGCCCCTACCGAGGATTGCGACTGGTGGTGCTTCGACGATGCGGTCG
TGCTCGACCTCGCGGGCCGCTTCGCCGAGCCCGACGCGACCGACGACGACCGCCGCGCATGGGGCGCGCT
GCTCGAACAGCTCGGCCGCGCGCGCGCGCGCCGGGGCATCAACGGCGTCGTCGTCGCGATCGATGCGCCG
CGCCTCGTCACCGCAGATCGCGACGCGTTGACGATCGACGGCTGCGCGGTTCGCGAGCGGCTGGAGCAAC
TGATTCGCCTGTTCGACCGGCGCTTTCCGGTCTATGTGCTCGTCACGCAATGCGACCGGCTCTACGGCTT
CGACGAATGGGCCGCGCAGCTCGCGCCGGAGCAACGCGAGCGCGCATTCGGCTATCTCGGCGATCACGAT
GCGGATGCGTTCGTCGCGCACGCGCTCGAGCATGTCGACGCGCGGCTCGCCGCGCTGCGCATCGCGCTGG
CAGCGCGCGGCGAGCCGCCGTCGCCGCGCGCGCTGATGCTGCCGCACGAACTCGCGCGCTTGCGGCCCGC
GCTCGAAGCGCTCGCGCGCGCGGCGTTCGGCCCGAACGTCTATCAGGAAACGCCGTATCTGCGCGGGCTG
CTGTTCTCGAGCGGCCGGCAGGCGGGCGGCGCGCCGTCGCTGACGCTGCCCGACTGGCTCGACGCCGCGC
CGGCGCGCACGCCCGGCGACGCGGGCCTGTTCCTGCACGACGTGTTCGCGCGCGTGCTGCCGGGCGAGCG
CGACGCGTCGCGGCCCGTCGAGCGGCCGAGCCGCTCGCGGCTGACGCCGCGGCGTCTCGCACTGGCCGCG
TGGCTCTTCGCGTGCGTCGCGGCCGGGCTGCTGATGAGCGCGTCGTTCGTCGGCGACATCCGAACGGTCG
AGCTGATCCGCCGCGACTATCCCGCGCATCCGCGCTTCACGGGCGAGCTCGCGCACGATGCGGCGACGCT
CGCGCGGATCGCTCGCGTGATCGCCGACGTCGAGCGGTGCGACGAGCGGCGGCTCGTGCGGCGGCTCGCG
CGCCCGATCGCCGACGCGACGCCTGTCGGCCGGCTCGAAGCGCAGCTCAAGCGCCGCTACATCGCGCATT
ATCGACGCGCGATCGAGCCGGCCGCCGACCGGCTGCTCTTCGGCGAGCCGGACGGCGCGAGCGGCGCGCG
CGCGGCGGACGACGGCGACATCGCCGTGCGCATCCGCAATCTGGTCCGCTACGTGAACCTGATGCAGGCG
CGCCGGCGCGGCGCGGATCGCGAGACGCTCGCGCGCATGCCCGCGCCGGCGCTCGCGCGCGCGCGGGATG
GCGGCGGCGCAAGCCGCGCGGACGGCGCGCGGAGCGCCGGCGGCATGAGCGACACCGGCGACTCGGGCGA
CACGAGCGATCGCACCGGCAGGCTGTCCGCGCTTATCGGCGCGCTCGCCGTAGACCGGATCGCGTGGAGC
GCGCCCGACGACGCCACGCTCGCCGCGCGGATCGCGGCCGCGCAGGCGCAGCTCGAACGGCTCGCGTACC
GCGACCCGGACGGCGCATGGCTGCTCGCGCTGCCCGACGCATCGGCGCCGCGCGACGTGACGCTCGCCGA
CTTCTGGCCGGCCGCCGCGCCGCGCACGCCGCCCCCCGAGCCGCGCGACGCGCGCGTTCCCGCCGCGCTG
ACGGCCGCGCATCGTCCGGCGATCGACGCGTTTCTCGACGAGATGGCGCAAGCGGTCGCGAACCGGCCGA
AGTTCGCGTTCCATCGCGACGCGTTCGACACGTGGTATCGCGCGCGGCGCATCGACGCGTGGCGCGACTT
CGTCGCGCGTTTTCCGCAGGGCGAGCAAGGGCTCGCGACGCAAGCGCAATGGCGCGCGGTGATCGACACG
ATTGCCGATCGCCGCGATCCGTTCGCGGCATTGCTCGCGCGCGTCGATCGCGAGTTCGAATCAGTTCGCG
ACGACGCGCTGCCGCCGTGGCTGCGGTTCGTCCGGACGGCGTCGCGCATGCTCGCGCCCGCGCGCGTGCC
CGCGGCGAGCGGCGGCCTCGGCGCGGCGCTCGGCTCGATCTCGCGCAGCGGCGGCCGCGCGCTGCGCGAG
GCGCTCGGCGGCGCGCCCGAGCAAGGCCGGCGCACGCTCGAGCGCGACGCCGCGCTGCGCGACGCGCTCG
TCGACTACGAGCGGCGCGTCGCCGCGCTCGCCGCCGACGCGCTCGCGGGTCCCGGCGCCGCGTACCGGCT
CGCGGCCGACTTCCACGGCTTCGGCGTCGATCCGTCCGTCGAGGCATCCGCGATGCGCGCGGCCGACGAT
GCGCTGCGCGACGTCAAGCGGCTCGCGGGCGAGCGCGATGTCGGCGGCGACGTCGTCTGGAGCCTCGTCG
GCGGTCCGCTGCACGCGGTGATCGCGTATGTCGAGCGGCAGGCGTCGTGCGCGCTGCAAGAGGACTGGGA
ACGCGACGTGCTGTGGCCGCTCAGGCGCGCGGCGACGCGCGAGGACGCCGACGACCGGCTGTACGGCCCG
CAAGGCGCGTTCTGGGCGTTCGTCGACGGCCCGGCGAAACCGTTCGTGCGCGTCGGCGCGGCGCGCGCGT
CGGCGGTCGACACGCTCGGCTACCGGCTGCCGTTCACCGACGCGTTCCTGCCGCTCGTCGACGACGCGGC
CGCCCGGCGCGTCGCGCAGGCGCGGCGCGCCGACGAGCAGCGCGCGCGACAGCAGGCGGCGGCCGAGCTC
GACGAGCGGATCGCTTCGCTCGGCAAGCAGATCGACGCGATCCGCGCGCAGACGGTGCGCATCGAAATCG
TCGCGCAGCCGACCGACGTGAACCCGGAAGCGCGAGCGCGGCCGTTCGAGACCGTGCTGACACTGCAATG
CGCGCCGCAGGCGCGCACGCTCGCGAACTACAACCTGCGCGTGTCCGAGCGGATCGACTGGCAACCCGAT
CAATGCGGCGACGCGACGCTGCGCATCGCGCTCGGCGGCGTCACGCTCACGCGCCGCTACGCGGGACCGC
TCGGCATCGCGCGCTTCGTCCAGGACTTCCGCTACGGCGTGCGCCGCTTCACGCCCGGCGATTTCCCGGA
TGCGAAAGCGCAACTCGAACGTCTCGGCGTGCGCCACGTCGACGTGCGCTACGACTTCTCGGGGCACGAC
GCGCTGCTCGCGCACGTCGAGCGGATCGACGCGCTCGAACGCGCCCGCCGCGACGACATCGCGCGGCAGC
GGCGCATCGCGAGCCGGCAGGACGACGGCGCAAGCGACAGCGGCGCGGCCGCGATCGCGCGTGCGGGCGG
CTTCGCCGCGAACCCGGCGAACCCGGCGAACACCGCGCGCGCACCGTCCGCATCGTCCCGATCGTCGCCA
TCGCCCGCGCCGGGCGCATCGGCCCCATCGGGCACGCCGGATGCCGGATTGCCCCGCCGCATCGGCGCGT
GCTGGGGCGATCCCGCGCGCGACGGCGGCATGCGCCCTTGA
 Primer design