SecReT6
Protein ID: 83716527
SecReT6 ID112
T6SS typei3
Gene symbol-
Locus tagBTH_II0254
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]308851..312480 [+]
Productlipoprotein
NoteTssM
UniProt IDQ2T8P3
KEGG IDbte:BTH_II0254
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.00E-96, Aligned region: 213..478
ImcF-related_N [PF14331], Evalue: 1.00E-96, Aligned region: 750..834
ImcF-related_N [PF14331], Evalue: 1.00E-96, Aligned region: 1062..1079
IcmF-related [PF06761], Evalue: 6.00E-95, Aligned region: 370..390
IcmF-related [PF06761], Evalue: 6.00E-95, Aligned region: 526..836
DUF1215 [PF06744], Evalue: 2.90E-34, Aligned region: 64..87
DUF1215 [PF06744], Evalue: 2.90E-34, Aligned region: 945..1069
AAA_16 [PF13191], Evalue: 0.0056, Aligned region: 148..272
AAA_16 [PF13191], Evalue: 0.0056, Aligned region: 490..545
AAA_16 [PF13191], Evalue: 0.0056, Aligned region: 679..705
AAA_16 [PF13191], Evalue: 0.0056, Aligned region: 931..931
AAA_16 [PF13191], Evalue: 0.0056, Aligned region: 1001..1057
Protein Sequence: 1209 a.a.     [Download]
>gi|83716527|ref|YP_438456.1| unnamed protein product [Burkholderia thailandensis E264]
MSHAVARIVRPLPSREIWTFAGLVGLACFVWLAGPLFAFAEFHPFESGWARALTIAALFVAWGARIAWRN
WRAGQLNAQLLNQLREASPRPAAPGDPARAQLDELRSRFDEASTLLKKVRFGAADGARKGLPQWLERMSR
QYLYQLPWYVFIGAPGSGKTTALVNSGLSFPLAEQFGRAAIRGVGGTRHCDWWFTNDAVLIDTAGRYTTH
ESNRALDEAEWNGFVDLLKKYRARQPLNGAMLTISVADLLGASEAERTQHAMVLRKRLLELRSQLGIRFP
VYLLVTKADLLAGFAEYFGGFGRAECAQVWGFTFPLAESEAPGFDLRAAFDREYRLLHKRLNDGLPELLA
SQTDAHQREMSYLLPQQIADLQDMLGQFVAEVFSVSSFEPMPMLRGVYLTSGTQEGTAFDRVMSGIKRFL
KIEGVPPAAQTGSTGRSFFLKSLLQDHIFREAALAGSNLRWHRRQRVLQIVGYAAIVLLCVAVLFAWLRS
YSRNRGYLDQVAARVPAVDAQISRAKFTGAADVVQLLPVLDELSGLPSAGGVDLRHPPLAYRWGLFQGEK
IEEASDAVYRRALDDVLLPIAASRMEQALREARPDEVEYAYAALKAYLMLYDGAHYDPAFVQAVVDLEME
RSLPADFSSAQRSALRSHLGALFGNRVAVSPFPMNERLVADVRERLRQVPFSQRLYRQLARTLRPSTATY
DFSVARAVGPDASLVFRRQSGKSLADGVPGLYTRDGYRNVFAPRLPGAIDAYGREEVWVLNLGASETPNP
ADAAAWARDIRQLYLNDYIKNWDDYLADIRLQHTSTLAQSIQVARTLSSADSPLTRLMVALARVTPLGDA
PGGARNLASRAQDKVDEARNSLAQIFAGQPGADAGAAAASPASPEQIVDSHFAGLRAFAPGGGDQAASFD
AVLKAIDALYTYLTATDDALRGGATPPPSDAPARLRAQAGRLPTPFREVLDDLSNVANGSVASVEQRNVA
QRAGANVGDFCRQAIAGRYPFARGASRDVAPSDFAQMFAAGGLMDDFFQKNLQTLVDTTTHPWRFNNRNA
EADPAAAAMLGSFEKAAVIRDVYFGGGARTAQIKVEIVPLEMDPSISEMVLDVDGQIVRYAHGPQVPTAV
QWPGPRGSDQVRLQVTEQSGATGGFTTEGPWALHRLFDRAGVSGGRGPEQMVARFAVDGKPIVLQVTASS
VRNPFRLPQMESFTCPPKQ
 
Nucleotide Sequence: 3630 bp     [Download]
>gi|83716035|ref|NC_007650.1|:308851-312480 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGAGCCACGCTGTCGCACGCATCGTTCGCCCGCTGCCGTCGCGGGAAATCTGGACGTTCGCCGGCCTCG
TCGGGCTGGCGTGCTTCGTCTGGCTCGCCGGGCCGCTGTTCGCGTTCGCCGAGTTCCACCCGTTCGAGAG
CGGCTGGGCGCGCGCGCTGACGATCGCCGCGCTGTTCGTCGCGTGGGGCGCGCGGATCGCGTGGCGCAAC
TGGCGCGCGGGCCAGCTGAACGCGCAGTTGCTGAACCAGTTGCGCGAAGCGTCGCCGCGGCCGGCCGCGC
CGGGCGACCCCGCGCGCGCGCAGCTCGACGAGCTGCGCAGCCGCTTCGACGAAGCGTCGACGCTCCTGAA
GAAAGTTCGCTTCGGCGCCGCCGACGGCGCGCGCAAGGGCCTGCCTCAATGGCTCGAACGGATGTCGCGC
CAGTATCTGTACCAACTGCCGTGGTACGTGTTCATCGGCGCGCCCGGCTCGGGCAAGACGACGGCGCTCG
TCAACTCGGGGCTCAGCTTTCCGCTCGCCGAGCAGTTCGGGCGCGCGGCGATTCGCGGCGTCGGCGGCAC
GCGGCACTGCGACTGGTGGTTCACGAACGACGCGGTGCTGATCGACACCGCGGGCCGCTATACGACGCAT
GAGAGCAATCGCGCGCTCGACGAGGCCGAATGGAACGGCTTCGTCGATCTGCTGAAGAAGTACCGCGCGC
GCCAGCCGCTGAACGGCGCGATGCTGACGATCAGCGTCGCCGATTTGCTCGGCGCGTCCGAGGCGGAGCG
CACGCAGCACGCGATGGTGCTGCGCAAGCGCCTGCTCGAGCTGCGCTCGCAGCTCGGCATTCGCTTTCCG
GTGTACCTGCTCGTGACGAAGGCGGACCTGCTCGCCGGCTTCGCCGAATACTTCGGCGGCTTCGGCCGCG
CGGAGTGCGCGCAGGTGTGGGGCTTCACGTTCCCGCTCGCCGAGAGCGAGGCGCCCGGCTTCGACTTGCG
CGCGGCGTTCGATCGCGAATATCGGCTGCTGCACAAACGGCTGAACGACGGGCTGCCCGAGCTGCTCGCG
TCGCAGACCGATGCGCACCAGCGCGAGATGAGCTACCTGCTGCCGCAGCAGATCGCCGATCTGCAGGACA
TGCTCGGCCAGTTCGTCGCCGAGGTGTTCTCGGTGTCGAGCTTCGAGCCGATGCCGATGCTGCGCGGCGT
GTACCTGACGAGCGGCACGCAGGAAGGCACCGCGTTCGACCGCGTGATGAGCGGGATCAAGCGCTTCCTG
AAGATCGAGGGCGTGCCGCCCGCCGCGCAGACGGGCTCGACCGGCCGCAGCTTCTTCCTGAAATCGCTGC
TGCAGGACCACATCTTCCGCGAGGCGGCGCTCGCCGGCAGCAATCTGCGCTGGCATCGGCGGCAGCGCGT
GCTGCAGATCGTCGGCTACGCGGCGATCGTGCTGCTGTGCGTCGCGGTGCTGTTCGCGTGGCTGCGCAGC
TACTCGCGCAATCGCGGCTACCTCGACCAGGTCGCCGCGCGCGTGCCGGCCGTCGACGCGCAGATCAGCC
GCGCGAAGTTCACGGGCGCGGCCGACGTCGTCCAGCTGCTGCCCGTGCTCGACGAGCTGAGCGGGCTGCC
GAGCGCGGGCGGCGTCGATTTGCGGCATCCGCCGCTTGCGTATCGCTGGGGCCTCTTTCAGGGCGAGAAG
ATCGAGGAGGCGAGCGACGCCGTGTACCGCCGCGCGCTCGACGACGTGCTGCTGCCGATCGCCGCGAGCC
GCATGGAGCAGGCGCTGCGCGAAGCGCGGCCCGACGAGGTCGAGTACGCGTACGCGGCGCTCAAGGCGTA
CCTGATGCTCTACGACGGCGCGCATTACGATCCCGCGTTCGTGCAGGCTGTCGTCGATCTCGAGATGGAG
CGCTCGCTGCCCGCCGATTTCTCGTCCGCGCAGCGCAGCGCGCTGCGCTCGCATCTCGGCGCGCTGTTCG
GCAATCGCGTCGCGGTGTCGCCGTTCCCGATGAACGAACGGCTCGTGGCCGACGTGCGCGAGCGGCTGCG
GCAGGTGCCGTTCTCGCAGCGGCTGTACCGGCAGCTCGCGCGCACGCTGCGCCCGAGCACCGCGACGTAC
GACTTCAGCGTCGCGCGCGCGGTCGGGCCGGACGCGTCGCTCGTGTTCCGCCGGCAGAGCGGCAAGAGCC
TCGCCGATGGCGTGCCGGGCCTCTACACGCGCGACGGCTACCGCAACGTGTTCGCGCCGCGGCTGCCCGG
CGCGATCGATGCGTACGGGCGCGAGGAGGTGTGGGTGCTGAATCTCGGCGCGTCCGAGACCCCGAATCCG
GCCGATGCGGCCGCCTGGGCGCGCGACATCCGGCAGCTCTATCTGAACGACTACATCAAGAACTGGGACG
ACTATCTGGCCGACATCCGGCTGCAGCACACGTCGACGCTCGCGCAGAGCATCCAGGTCGCGCGCACGCT
GTCGTCGGCCGATTCGCCGCTCACGCGGCTGATGGTCGCGCTCGCGCGCGTCACGCCGCTCGGCGATGCG
CCCGGCGGCGCGCGCAACCTCGCGTCGCGCGCGCAGGACAAGGTCGACGAGGCGCGCAATTCGCTTGCGC
AGATCTTCGCCGGCCAGCCGGGCGCGGACGCGGGCGCGGCGGCCGCCTCGCCCGCGAGCCCCGAGCAGAT
CGTCGACAGCCACTTCGCGGGGCTGCGCGCGTTCGCGCCGGGCGGCGGCGATCAGGCGGCGTCGTTCGAC
GCGGTGCTCAAGGCGATCGACGCGCTGTACACGTATTTGACCGCGACCGACGACGCGCTGCGCGGCGGCG
CGACGCCGCCGCCGTCGGACGCGCCCGCGCGGCTGCGCGCGCAGGCGGGCCGGCTGCCGACGCCGTTTCG
CGAGGTGCTCGACGATCTGTCGAACGTCGCGAACGGCAGCGTCGCGAGCGTCGAGCAGCGCAACGTCGCG
CAGCGCGCGGGCGCGAACGTCGGCGATTTCTGCCGGCAGGCGATCGCCGGGCGCTATCCGTTCGCGCGCG
GCGCGTCGCGCGACGTCGCGCCGTCCGACTTCGCGCAGATGTTCGCGGCGGGCGGCCTGATGGACGACTT
CTTCCAGAAGAACCTGCAGACGCTCGTCGACACGACCACGCACCCGTGGCGCTTCAACAACCGCAACGCC
GAAGCCGACCCGGCGGCGGCCGCGATGCTCGGCTCGTTCGAGAAGGCCGCGGTGATCCGCGACGTCTATT
TCGGAGGCGGCGCGCGGACCGCGCAGATCAAGGTCGAGATCGTACCGCTCGAAATGGACCCGTCGATCTC
GGAGATGGTGCTCGACGTCGACGGCCAGATCGTCCGCTACGCGCACGGCCCGCAGGTGCCGACGGCGGTG
CAGTGGCCCGGCCCGCGCGGCAGCGATCAGGTGCGGCTGCAGGTGACCGAGCAGTCGGGCGCGACGGGCG
GCTTCACGACCGAGGGGCCGTGGGCGCTGCACCGGCTGTTCGATCGCGCGGGCGTGTCGGGCGGGCGCGG
GCCCGAGCAGATGGTCGCGAGATTCGCGGTGGACGGCAAGCCGATCGTGCTGCAGGTGACGGCGAGCAGC
GTGCGCAACCCGTTCCGGCTGCCGCAGATGGAGTCCTTTACATGCCCTCCGAAGCAATGA
 Primer design