SecReT6
Protein ID: 83716562
SecReT6 ID111
T6SS typei3
Gene symbol-
Locus tagBTH_II0127
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]146525..150433 [+]
Productlipoprotein
NoteTssM
UniProt IDQ2T920
KEGG IDbte:BTH_II0127
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.50E-97, Aligned region: 42..57
ImcF-related_N [PF14331], Evalue: 1.50E-97, Aligned region: 264..541
IcmF-related [PF06761], Evalue: 4.50E-91, Aligned region: 393..484
IcmF-related [PF06761], Evalue: 4.50E-91, Aligned region: 589..913
DUF1215 [PF06744], Evalue: 3.30E-33, Aligned region: 1036..1159
AAA_33 [PF13671], Evalue: 0.0017, Aligned region: 193..301
DUF2267 [PF10025], Evalue: 0.0081, Aligned region: 127..165
DUF2267 [PF10025], Evalue: 0.0081, Aligned region: 441..489
DUF2267 [PF10025], Evalue: 0.0081, Aligned region: 641..666
DUF2267 [PF10025], Evalue: 0.0081, Aligned region: 1041..1051
Protein Sequence: 1302 a.a.     [Download]
>gi|83716562|ref|YP_438329.1| unnamed protein product [Burkholderia thailandensis E264]
MSYLKRFFRFVFSWQMLACIAVLLVSVAVWFVGPLLAFDELRPLAGVVVRVAVIVLLVALLAFWLMRWPL
SPVGVAALCLLIWHAGPLFAFGDHRPFGPAWVRVLIVAVILFCYAVYGLYRLWQAVRTNDALLRRILDPS
AGKPDAAARADIRAVNVAVSKAIGQLKRLRGGAFGWRRLLESGRYLYELPWYMMVGAPGAGKTAAIARSG
LKFPLADQMEASTERARGGTINCDWWFANEAVLIDTAGRYARHEVPGDEEATLANEAEWKGFLGLLRKHR
PRAPVNGVVLSVSVEDLVGRTPAERTAHAAALRARLGELHQELGIHFPVYVIVTKLDLLPGFPEYFQSLT
AEGRTQIWGFTLPYDAENRKSAVGALREHCADELKRLEMRIDAGLNNRLLEEYENDRRKRLYALPQEFRS
LSEALTDMLGLVFLDSRYDDAQLQNTLRGVYFTSAEQTDQVMAADRETILQRLKRQLGRMLGGDAGAQTR
GNGAMSGSRGYFLRDVFQHVIVPEAHLVRPNVMWEVRFRLMRWAGHLLAVALLVWLASSLTVSFDSNRGY
LDAISDKTTALAARVNAYNKAPKPAGVAGVLDGSRDLPQYGNLDLEAPGASFRYGLYVAPGIVDASDATY
RNLLRRSLLPQIVRRVENALSAQIDAKNADEVYRTLTIYLMLYDAARHDAKAVKDWVMRDWERSDSAAEM
GGRNRMARHLDALFVDGQPFEPSGRQNAALVQRARLFLNANPAPRRLYERAMAAIEKEAPENFTLARAVG
LQGAGIFRLVDGSRFQRGVPGLYTYEGYHQVFSARLPEFLARAQSDDAWVMGSADSAARWGDAIRNTKIV
AGRSALADDIRRQYLTDYGNYWQQYLADIRPVSSGENGGSGTLAFDLATLRALAAPDSPLVRLARAVVRE
TSLSVVDAREDASLTDTALSAVGRRSGTAKEVADGAQKLAARRPEQRLEKELVDNRFAALREVVTGQADT
GSGPAMTDMPISSGGKALQLDAILTLINEQYTRLVVADNALSSHSMPPALDIGTTLQMEAEKLPAPLRAV
LGGIATQAADKVGREVGSLLAMQVDSSVGKACRAAVDGKYPFARSSQEVDIEDFNRLFAAGGLFDEFFQK
ALAAHVDTNSKPWRYKALNPGMPPIRGPSLEPFERAAAIREVFFREPGAKRMAWKMDAKVASIDPEITEF
IVDVDGQSQRYVHGPVLPFSVNWPGPRGGAIAEITAKPRIRPDTSTITTTGPWALFRLIERGRLTGTTSA
SRLMLDFDFDGRRAALELRTNGQANPLTSGLLTNFRCPGSLG
 
Nucleotide Sequence: 3909 bp     [Download]
>gi|83716035|ref|NC_007650.1|:146525-150433 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGTCTTACCTGAAACGTTTCTTCAGATTCGTCTTTTCGTGGCAGATGCTCGCGTGCATCGCGGTGCTGC
TCGTCTCCGTCGCCGTATGGTTCGTCGGCCCCTTGCTCGCGTTCGACGAGTTGAGGCCGCTAGCGGGCGT
CGTCGTGCGCGTCGCCGTCATCGTCCTTCTGGTGGCGCTCCTGGCGTTCTGGCTGATGCGCTGGCCGCTC
AGCCCGGTCGGTGTCGCCGCGCTGTGTCTGCTGATCTGGCACGCGGGGCCGCTCTTCGCGTTCGGCGATC
ACCGTCCGTTCGGACCTGCATGGGTTCGCGTGCTGATCGTCGCCGTGATTCTGTTCTGCTACGCCGTCTA
TGGCCTCTATCGCCTGTGGCAGGCGGTGCGGACGAACGACGCATTGCTCAGGCGCATTCTCGATCCGTCG
GCGGGCAAGCCGGACGCGGCGGCGCGTGCGGACATCCGCGCGGTGAACGTGGCGGTGTCGAAGGCGATCG
GTCAGTTGAAGCGCTTGCGCGGCGGTGCATTCGGCTGGCGGCGCTTGCTCGAAAGCGGACGCTATCTGTA
CGAACTGCCGTGGTACATGATGGTCGGCGCGCCTGGTGCGGGCAAGACCGCGGCGATCGCGCGTTCCGGT
CTGAAATTCCCGCTCGCGGATCAAATGGAGGCATCGACCGAGCGCGCTCGGGGCGGCACGATCAATTGCG
ACTGGTGGTTCGCCAATGAGGCCGTGTTGATCGATACGGCAGGCCGTTACGCTCGGCACGAGGTGCCCGG
CGACGAAGAGGCGACGCTCGCCAACGAAGCGGAGTGGAAGGGCTTTCTCGGCCTGCTTCGCAAACATCGG
CCGCGCGCGCCGGTCAACGGTGTGGTCCTGTCGGTCAGCGTCGAGGATCTCGTCGGACGGACGCCGGCCG
AGCGCACCGCGCATGCGGCCGCGCTGCGCGCCCGCCTCGGCGAGCTGCATCAGGAACTGGGCATTCATTT
TCCGGTATACGTGATCGTCACGAAGCTCGATTTGCTGCCGGGCTTTCCGGAGTATTTCCAGTCGCTGACG
GCTGAAGGGCGCACGCAGATCTGGGGATTTACGCTGCCCTACGACGCCGAGAACAGGAAGAGCGCGGTGG
GTGCCCTGCGCGAGCATTGCGCCGATGAACTGAAGCGGCTGGAGATGCGCATCGACGCCGGACTGAACAA
CCGCCTGCTCGAAGAGTACGAAAACGATCGCCGCAAGAGGCTGTATGCGTTGCCGCAGGAGTTCCGGAGC
CTGTCTGAGGCGTTGACGGACATGCTGGGCCTCGTGTTTCTCGATTCGCGCTACGACGACGCCCAGTTGC
AGAACACGCTGCGCGGCGTCTATTTCACGAGCGCCGAGCAGACGGATCAGGTGATGGCCGCCGATCGCGA
AACCATCCTGCAGCGCTTGAAGCGCCAGCTCGGCAGAATGCTTGGCGGCGACGCCGGGGCGCAGACGCGC
GGTAACGGCGCGATGTCGGGCAGCCGCGGCTATTTCCTGCGCGATGTGTTCCAGCACGTGATCGTGCCGG
AGGCGCACCTGGTTCGGCCGAACGTCATGTGGGAAGTGCGCTTTCGCCTGATGCGCTGGGCCGGACATCT
GCTCGCCGTCGCGCTGCTGGTCTGGCTGGCGAGTTCGCTGACGGTGAGCTTCGACAGCAATCGCGGCTAT
CTCGATGCGATATCGGACAAGACGACCGCCCTCGCCGCGCGAGTCAACGCGTACAACAAGGCGCCGAAAC
CGGCAGGAGTCGCGGGCGTGCTGGACGGCTCTCGCGATCTTCCCCAGTACGGAAATCTCGATCTCGAGGC
GCCGGGCGCGAGCTTCCGCTACGGCCTGTATGTGGCGCCCGGCATCGTCGACGCGTCCGACGCGACCTAT
CGGAACCTGCTGCGCCGGAGCCTTCTGCCGCAGATCGTGCGGCGTGTCGAGAATGCGCTGAGCGCGCAGA
TCGATGCGAAGAATGCGGACGAGGTCTATCGCACGCTGACGATCTACTTGATGCTCTACGACGCCGCGCG
CCATGACGCGAAGGCGGTGAAGGACTGGGTCATGCGCGACTGGGAGCGCTCGGACAGCGCGGCCGAGATG
GGCGGACGCAATCGGATGGCGCGGCACCTGGACGCGCTGTTCGTCGACGGTCAGCCGTTCGAGCCGAGCG
GACGCCAGAACGCCGCGCTCGTTCAGCGCGCGCGGCTTTTCCTCAACGCGAATCCGGCGCCGAGGCGGCT
GTACGAGCGCGCGATGGCCGCGATCGAGAAAGAGGCGCCGGAGAACTTCACGCTCGCGCGCGCGGTCGGG
CTTCAGGGCGCGGGAATCTTCAGGCTCGTCGACGGTTCGCGATTTCAACGCGGCGTGCCGGGCTTGTATA
CGTACGAAGGCTACCATCAGGTGTTCAGCGCTCGGCTGCCCGAATTTCTCGCCCGCGCGCAAAGCGACGA
TGCATGGGTGATGGGGAGCGCCGATTCCGCCGCGCGATGGGGCGACGCGATCCGGAACACGAAGATCGTT
GCAGGGCGCTCGGCGCTTGCCGACGACATTCGTCGCCAGTACCTGACGGATTACGGCAACTATTGGCAAC
AGTATCTGGCGGACATTCGGCCCGTCTCGTCCGGGGAAAACGGCGGGAGCGGCACGCTCGCGTTCGACCT
CGCGACGCTGCGCGCACTCGCCGCGCCCGATTCGCCGCTCGTGAGACTGGCGCGCGCCGTCGTTCGCGAA
ACATCGTTGTCGGTCGTCGACGCAAGGGAAGACGCGTCGTTGACCGACACGGCGCTTTCGGCGGTCGGGC
GACGGTCCGGCACGGCGAAGGAGGTTGCCGACGGCGCGCAGAAACTGGCGGCGCGCAGGCCGGAGCAGCG
CCTGGAGAAGGAACTGGTGGATAACCGCTTCGCGGCGCTGCGCGAGGTGGTGACGGGGCAGGCCGATACG
GGAAGCGGTCCCGCGATGACGGACATGCCGATCTCGTCGGGCGGCAAGGCGCTGCAGCTCGATGCAATTC
TCACGCTGATCAACGAACAGTACACGCGTCTCGTCGTCGCCGACAACGCCCTCTCGTCACACAGCATGCC
GCCCGCGCTGGATATCGGCACCACATTGCAAATGGAGGCGGAGAAATTGCCCGCGCCGCTGCGCGCCGTG
CTGGGCGGCATCGCGACGCAAGCCGCCGACAAGGTCGGGCGCGAAGTGGGTTCGCTGCTCGCGATGCAGG
TGGACTCGAGTGTCGGCAAGGCGTGCCGCGCCGCCGTCGACGGCAAGTATCCGTTCGCGCGGAGCAGCCA
GGAGGTGGACATCGAGGATTTCAACCGCCTCTTCGCCGCGGGCGGGCTGTTCGACGAGTTCTTTCAGAAG
GCGCTTGCCGCGCATGTCGACACCAACTCGAAGCCGTGGCGCTACAAGGCGTTGAACCCCGGCATGCCGC
CGATTCGGGGGCCGAGCCTCGAGCCGTTCGAGCGCGCCGCCGCGATTCGCGAAGTGTTCTTTCGTGAGCC
GGGCGCGAAGCGGATGGCGTGGAAGATGGACGCGAAGGTGGCGTCCATCGATCCCGAGATCACCGAGTTC
ATCGTCGATGTCGACGGCCAGTCGCAGCGCTATGTCCACGGTCCGGTGCTGCCGTTCTCCGTGAACTGGC
CCGGGCCGCGCGGCGGCGCGATCGCGGAGATCACCGCGAAGCCGCGGATTCGTCCCGATACGTCGACGAT
CACGACGACGGGGCCCTGGGCGCTGTTTCGCCTGATCGAGCGCGGGCGGCTGACGGGCACCACGTCGGCG
AGCCGGTTGATGCTGGATTTCGATTTCGACGGCCGGCGCGCGGCTCTGGAGCTCAGGACGAACGGCCAGG
CGAATCCGTTGACGAGCGGCTTGCTGACGAATTTTCGCTGCCCGGGGAGCCTCGGTTGA
 Primer design