SecReT6
Protein ID: 83716717
SecReT6 ID114
T6SS typei3
Gene symbol-
Locus tagBTH_II1885
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]2282208..2285702 [-]
ProductImcF-like family protein
NoteTssM
UniProt IDQ2T420
KEGG IDbte:BTH_II1885
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.00E-69, Aligned region: 261..348
IcmF-related [PF06761], Evalue: 1.00E-69, Aligned region: 490..796
IcmF-related [PF06761], Evalue: 1.00E-69, Aligned region: 867..877
ImcF-related_N [PF14331], Evalue: 2.90E-30, Aligned region: 188..376
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 80..99
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 304..318
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 901..1026
Protein Sequence: 1164 a.a.     [Download]
>gi|83716717|ref|YP_440079.1| unnamed protein product [Burkholderia thailandensis E264]
MIRTSLRVFAAILIAILIWWVGPLFAFGIYHPLGPVWVREILVALVLIWGFWPTLARLWARLAMSPRQVK
VAPKTKQLDFVDKHLRNLDQQLKERWRKEPRGRWKRWVGTLTREHRAMLPWYLVLGSEGSGKTSLVAKAV
SVSGSLQDRVLGSDATYGRGDDFNFRITREAVWFDVGGRWSLRAGADEAEFDAWRKLLRGMRRLRKGAPI
SGVVLCVDGLDMVDAPLDARKRLADSVRARLEEMREAFGQQVQVYVALNGLDRLDGAVSTLSLLDASKWA
KGVGFSLPDDGAEADAARADANWQHALQGLQQRVQQQVLYSAPAATEVSMNHAQLRFVETLSRLQKALVA
WLHVALAPGEPHTAARLRGVWLGSMAELAEAHPAGVGSSELPVPSRPLSELWTPLIRQVSLERDAVRPSG
PKSWRGRLGEALRWGAVPLVALSLLLWFGWGYVTERDYLDGVWAQFTEAKRLAQAEASYGNDGGSALIEI
ANQMRYAQLQAEDAAQGMATPYFEHGLVAETARETYYRHLQKMLMPELYNEVRRTLVSQVDGTPGDIYQT
LKVYLMLCRPDRRSADDVVRWLDGRWDALSGGQYSDDDRRSLLGHVRTLMSLKNVPATPEDANLVRSARA
KAAQIPLVTRVLQHIHAQGLPQQVNDISLSRAAGFEASMSLRMRSNVPSTDTAVSGWFTRAGYTDVFLPR
LQKSARAMLEEESWVLRDETLSGNSFQIDGLVQKLADSARNQFLQDYISAWQNFLNDVTVRGVTGLDDAS
QLAAAMMEAQSPLANLLRFAARETTLTGASDEGNIDSWIDRQKYRFEKGRRQIVGELSGQHYRTVLLPEH
VVEEHFQAIRQLAAQLNRNNTIANNPLSRLFEPLYRQLGLVNGALQAGQVLPAQYDAFSRLKETAARQPE
PVRGIMLDLVSSGSTMTTRESGALLNRGAAGATKMVCDQGFTGRYPMRRNAQADAGVEDFERLFSAQGLM
ATYFRDHLAAYVDTSAKPWQALRSNGGPNGMVSQSVLNSYETADRIRGAMLDDSGHLRVSTVLRFIDMDS
QLSEAQLSVAGQTVRFAHGVTSPHRVDWTNQNTQLAIKLQLKSVDGRMTTLQFDGPWALFRFFDAGQAVG
GTGTADRRERLYQTSLGTVRIEWQALTLPSPIWSGILQSFRCPS
 
Nucleotide Sequence: 3495 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c2285702-2282208 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGATCCGCACGAGCTTGAGAGTATTCGCGGCGATTCTGATCGCGATCCTGATCTGGTGGGTGGGGCCGC
TCTTCGCGTTCGGCATCTATCACCCGCTCGGCCCCGTGTGGGTGCGCGAGATCCTCGTCGCGCTCGTGCT
GATCTGGGGCTTCTGGCCGACGCTCGCGCGGCTCTGGGCGCGGCTCGCGATGAGCCCGCGGCAGGTGAAG
GTCGCGCCGAAGACGAAGCAGCTCGATTTCGTCGACAAGCATCTGCGCAACCTCGACCAGCAGTTGAAGG
AACGCTGGCGCAAGGAGCCGCGCGGCCGCTGGAAGCGCTGGGTCGGCACGCTCACGCGCGAGCATCGCGC
GATGCTGCCGTGGTATCTGGTGCTCGGCTCCGAGGGCAGCGGCAAGACGAGCCTCGTCGCGAAGGCGGTC
AGCGTGTCCGGCTCGCTGCAGGATCGCGTACTCGGCTCGGACGCGACCTACGGGCGCGGCGACGACTTCA
ACTTCCGGATCACGCGCGAGGCCGTGTGGTTCGACGTCGGCGGCCGCTGGAGCCTGCGTGCGGGCGCGGA
CGAGGCCGAGTTCGACGCGTGGCGCAAGCTGCTGCGCGGGATGAGGCGGCTGCGCAAGGGCGCCCCGATC
AGCGGCGTCGTGCTGTGCGTCGACGGCCTCGACATGGTCGATGCGCCGCTCGACGCGCGCAAGCGCCTGG
CCGATTCGGTGCGCGCGCGGCTCGAGGAAATGCGCGAGGCGTTCGGCCAGCAGGTGCAGGTGTATGTCGC
GCTGAACGGGCTCGACCGGCTCGACGGCGCGGTGTCGACGCTGTCGCTGCTCGACGCGTCGAAGTGGGCG
AAGGGCGTCGGCTTCAGCCTGCCCGACGACGGCGCGGAAGCCGACGCGGCGCGCGCGGACGCGAACTGGC
AGCACGCGCTGCAAGGGCTGCAGCAGCGTGTGCAGCAGCAAGTGCTGTATTCGGCGCCGGCCGCGACCGA
GGTGTCGATGAACCACGCGCAACTGCGCTTCGTCGAGACGCTCAGCCGGCTGCAGAAGGCGCTCGTCGCG
TGGCTGCACGTCGCGCTCGCGCCGGGCGAGCCGCACACGGCCGCGCGGCTGCGCGGCGTGTGGCTCGGTT
CGATGGCCGAGCTCGCGGAGGCGCATCCGGCGGGCGTCGGCTCGTCGGAGCTTCCCGTGCCGTCCCGGCC
GCTCAGCGAGCTGTGGACGCCGCTCATCCGGCAGGTGTCGCTCGAGCGCGATGCGGTGCGCCCGAGCGGC
CCGAAGTCGTGGCGCGGCCGCCTGGGCGAGGCGCTGCGATGGGGCGCGGTGCCCCTCGTCGCGCTGAGCC
TCCTGCTGTGGTTCGGCTGGGGCTACGTCACCGAGCGCGATTATCTGGACGGCGTGTGGGCGCAGTTCAC
CGAGGCGAAGCGGCTCGCGCAGGCCGAGGCGTCCTACGGCAACGACGGCGGCTCGGCGCTCATCGAGATC
GCGAACCAGATGCGCTACGCGCAGTTGCAGGCCGAGGACGCCGCGCAGGGGATGGCCACGCCGTACTTCG
AGCACGGGCTCGTCGCCGAGACCGCGCGCGAGACCTACTACCGGCACTTACAGAAGATGCTGATGCCGGA
GCTGTACAACGAGGTGCGGCGCACGCTCGTGTCGCAGGTCGACGGCACCCCGGGCGACATCTATCAGACG
CTGAAGGTCTACCTGATGCTCTGCCGTCCTGATCGACGCTCGGCGGACGACGTCGTGCGCTGGCTCGACG
GCCGGTGGGACGCGCTATCGGGCGGCCAGTATTCGGACGACGACCGCCGCTCGCTGCTTGGGCATGTGCG
CACGCTGATGTCGCTGAAGAACGTGCCGGCGACGCCGGAGGACGCGAACCTCGTGCGCTCGGCGCGTGCG
AAGGCCGCGCAGATCCCGCTCGTCACGCGCGTGCTGCAGCACATCCATGCGCAGGGGCTGCCGCAGCAGG
TCAACGACATCTCGCTGTCGCGCGCGGCGGGCTTCGAGGCGTCGATGAGCCTGCGCATGCGCAGCAACGT
GCCGTCGACGGACACCGCGGTCTCCGGCTGGTTCACGCGCGCCGGCTACACGGATGTGTTCCTGCCGCGC
CTGCAGAAGAGCGCGCGCGCGATGCTCGAGGAGGAGAGCTGGGTGCTGCGCGACGAGACGCTGTCGGGCA
ACAGCTTCCAGATCGACGGACTCGTGCAGAAGCTCGCCGATTCGGCGCGCAACCAGTTCCTTCAGGATTA
CATCTCCGCATGGCAGAACTTCCTGAACGACGTGACGGTGCGCGGCGTGACGGGCCTCGACGACGCGTCG
CAGCTCGCGGCCGCGATGATGGAGGCGCAATCGCCGCTCGCGAACCTGCTGCGCTTCGCCGCGCGCGAGA
CGACGCTCACGGGCGCGAGCGACGAGGGCAACATCGACAGCTGGATCGATCGCCAGAAGTACCGCTTCGA
GAAGGGGCGGCGGCAGATCGTCGGCGAGCTGAGCGGGCAGCATTACCGCACGGTGCTGCTGCCGGAGCAC
GTGGTCGAGGAGCACTTCCAGGCGATCCGCCAGCTCGCCGCGCAGTTGAACCGCAACAACACGATTGCGA
ACAATCCGCTGTCGCGCCTGTTCGAGCCGCTGTACCGGCAGCTCGGGCTCGTCAACGGCGCGCTGCAGGC
GGGCCAGGTGCTGCCCGCGCAGTACGACGCGTTCTCGCGGCTCAAGGAGACGGCCGCGCGTCAGCCGGAG
CCCGTGCGCGGGATCATGCTCGACCTCGTGAGCAGCGGCAGCACGATGACGACGCGCGAATCGGGCGCGC
TGCTCAATCGCGGCGCGGCGGGCGCGACGAAGATGGTCTGCGATCAGGGCTTCACGGGCCGCTATCCGAT
GCGCCGCAACGCGCAGGCGGATGCGGGCGTCGAGGACTTCGAACGATTGTTCAGCGCGCAAGGGCTGATG
GCGACGTACTTCCGCGATCACCTCGCCGCGTATGTCGACACGTCCGCGAAGCCGTGGCAGGCGCTGCGCT
CGAACGGCGGGCCGAACGGGATGGTCAGTCAGTCCGTCCTGAACTCGTACGAGACGGCAGATCGCATCCG
CGGCGCGATGCTCGACGATTCGGGGCACCTGCGCGTGTCGACCGTGCTGCGCTTCATCGACATGGATTCG
CAGTTGTCCGAAGCGCAGTTGAGCGTCGCCGGCCAGACAGTGCGCTTCGCGCACGGCGTGACGTCGCCGC
ACCGGGTCGACTGGACCAATCAGAACACGCAGCTCGCGATCAAGCTGCAGCTGAAGTCCGTCGACGGCCG
GATGACGACGCTGCAGTTCGACGGGCCGTGGGCGCTGTTCCGCTTCTTCGACGCGGGACAGGCGGTGGGC
GGCACGGGCACGGCGGACCGGCGCGAGCGGCTCTATCAGACGAGCCTCGGCACGGTCCGGATCGAATGGC
AGGCGCTCACGCTGCCGTCGCCGATATGGTCGGGCATCCTGCAGTCGTTCAGGTGTCCGTCGTGA
 Primer design