SecReT6
Protein ID: 83721202
SecReT6 ID115
T6SS typei4b
Gene symbol-
Locus tagBTH_I2954
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3396298..3400203 [+]
ProductImcF-like family protein
NoteTssM
UniProt IDQ2SUD8
KEGG IDbte:BTH_I2954
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.90E-72, Aligned region: 189..445
IcmF-related [PF06761], Evalue: 4.60E-53, Aligned region: 494..862
DUF1215 [PF06744], Evalue: 3.40E-28, Aligned region: 994..1109
Protein Sequence: 1301 a.a.     [Download]
>gi|83721202|ref|YP_443461.1| ImcF-like family protein [Burkholderia thailandensis E264]
MQRFLNVLTHPRTLTIVGFAALAAVLFIAADALQIGFVWAAGALAVALALWLATKLWRRSRVRRANRQLG
DMLEQQAETGKVSAAVAEPAKRADLDVLRTRLADSVKTIKTSKIGQVSGGSALYELPWYIVIGNPAAGKS
SAVINSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLDLLKRYRPKA
PINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSSDRQE
YDRVWGATLPYEPDEKRDVVALFDQRFEELYDGLKEISVAQLSISRGNKLSPGQLSFPLEFSTIKPALRS
FLATLFEDNPFQYKPIFRGFYFTSALQEGETNSAAAQRIANRFGLDSQSLPKPHSAFSKNGFFLRDLFSK
VIFADRQTVRQFASPTKTRVRYATFFGFVAALALALGGWTWSTIGNQQLVSNVQADLDNVTRLQQNRNDL
QSRLQAMDILEDRIEQLEQFRRDKPLSVSLGLYQGNRLEQHLLTEYYNGVRQILLAPVSDNLASFLKDVN
AHPDQLAPMTRAPESGATPAGPMPVSANPAAAPGTAPSPAVAPNQQQGGLYNDASPTNVEDAYNALKTYL
MLSDKRHVEQAHLTDQVARFWRGWLETNRGNMPRDEMIKSAERMITFYLSRVSDNDWPMIEANLALVDQT
RENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIVGEGNTGLVAGSYAIPGTFTREAWFQYVQPAIR
DAATKELQAKDWVLNTASADDLTLEGSPEQIQKTLVAMYKTEYAQHWQKFMQGIAVQGFGNFTQAVDAMN
KLGDPQDSPIRKVLETAYDQTSWDNPSLANATIRKAQTGVVNWVKQWFTRQPGGQIAANVDINGNPADVP
MGPIGQEFVGLGRIVATHDGTSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGNGSELADSL
KFVDEQMLTGLTDSQRKSLRPLLVRPLMQAFAVVIQPASVEVNKVWNAQVYQPFQNSLANKYPFAAGAKV
EAGAGEIAQVFGPDGSIAKFVGATLGPLAVRRGDTLSARTWGDMGLALTPDFTSGFARWVAPLAGGAATS
AAGSSEPQTVFQVLPQPSSGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGSPGATLSATTFDGRTVQL
VNEPGRYGLEKLINSAQRKRRADGTFDLTWTQGSVSVSVTMRIISTSQPTGGGGDQPQQQSLRGLRLPSS
VADASAGGAANATAQPGSGGTAAAPQAAVATASASNAQGAQ
 
Nucleotide Sequence: 3906 bp     [Download]
>gi|83718394|ref|NC_007651.1|:3396298-3400203 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGCAACGCTTCCTCAACGTGTTGACTCACCCTCGCACGCTCACGATCGTCGGCTTCGCCGCGCTCGCGG
CGGTTCTGTTCATCGCGGCCGATGCGCTACAGATCGGCTTCGTATGGGCGGCCGGCGCGCTCGCCGTCGC
GCTCGCGCTCTGGCTCGCGACGAAGCTCTGGCGCCGCTCGCGCGTGCGCCGCGCGAATCGCCAGCTCGGC
GACATGCTCGAGCAGCAGGCCGAAACGGGCAAGGTGTCCGCCGCCGTGGCCGAGCCCGCCAAGCGGGCGG
ACCTCGACGTGCTGCGCACCCGCCTTGCCGACTCCGTGAAGACGATCAAGACCTCGAAGATCGGCCAGGT
GTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAACCCGGCCGCGGGCAAGAGC
AGCGCCGTCATCAACTCGGGGCTGCAGTTTCCGTTCGCGGACAAGAACAGCGCGGTGATCCACGGCATCG
GCGGCACGCGCAACTGCGACTGGTTCTTCACGACGGAAGGCATCCTGCTCGACACCGCGGGCCGTTATTC
GGTGCACGAGGAAGACCGCAGCGAATGGCTCGGCTTCCTCGATCTGCTCAAGCGCTATCGTCCGAAGGCG
CCGATCAACGGGATCATCGTGACGGCGAGCATCGCCGAGCTGACGGGCAACCGTCCCGAATTCGCGATCA
ACCTCGCGAAGAACCTGCGCCAGCGCGTGCAGGAGCTCACCGAGAAGCTCGAAGTGTTCGCGCCCGTCTA
CGTGATGTTCACGAAGGCCGACCTGATCACGGGCTTCACCGAGTTCTTCAGCAGCAGCGACCGCCAGGAA
TACGACCGCGTGTGGGGCGCGACGCTGCCGTACGAGCCGGACGAGAAGCGCGATGTCGTCGCGCTGTTCG
ATCAGCGCTTCGAAGAGCTGTATGACGGGCTGAAGGAGATCAGCGTCGCGCAACTGTCGATCAGCCGCGG
CAACAAGCTTTCGCCCGGCCAACTGAGCTTCCCGCTCGAATTCTCGACGATCAAGCCCGCGCTGCGCTCG
TTCCTCGCGACGCTGTTCGAGGACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCTTCTATTTCACCA
GCGCGTTGCAGGAAGGCGAAACGAACAGCGCGGCCGCGCAGCGGATCGCGAACCGCTTCGGCCTTGATTC
GCAAAGCCTGCCGAAGCCGCACAGCGCATTCTCGAAGAACGGCTTCTTCCTGCGCGACCTGTTCTCGAAG
GTGATCTTCGCGGACCGCCAGACAGTCCGCCAGTTCGCGAGCCCGACGAAGACGCGCGTGCGCTACGCGA
CGTTCTTCGGCTTCGTCGCGGCGCTCGCGCTCGCGCTCGGCGGCTGGACGTGGTCGACGATCGGCAACCA
GCAGCTCGTCTCGAACGTGCAAGCCGACCTCGACAACGTGACCCGCCTGCAGCAGAACCGCAACGACCTG
CAGTCGCGCCTGCAGGCGATGGACATCCTCGAGGACCGGATCGAGCAGCTCGAGCAGTTCCGCCGCGACA
AGCCGCTGTCCGTGTCGCTCGGCCTGTATCAGGGCAACCGGCTCGAGCAGCATCTGCTGACCGAGTACTA
CAACGGCGTGCGGCAGATCCTGCTCGCCCCCGTGTCGGACAACCTCGCCTCGTTCCTGAAGGACGTGAAC
GCGCACCCGGACCAGCTCGCGCCGATGACGCGCGCCCCGGAATCGGGCGCGACGCCCGCAGGCCCGATGC
CGGTGTCGGCGAATCCCGCAGCTGCGCCGGGTACCGCCCCCTCCCCTGCCGTCGCGCCGAACCAGCAACA
GGGCGGCCTGTATAACGACGCGTCGCCGACCAACGTCGAGGACGCGTACAACGCGCTGAAGACCTACCTG
ATGCTGTCCGACAAGCGGCACGTCGAGCAGGCGCACCTGACCGATCAGGTCGCGCGCTTCTGGCGCGGCT
GGCTCGAGACGAATCGCGGCAACATGCCACGCGACGAGATGATCAAGAGCGCGGAGCGGATGATCACGTT
CTACCTGTCGCGCGTGTCCGACAACGATTGGCCGATGATCGAGGCGAATCTCGCGCTCGTCGATCAGACC
CGCGAGAACCTGCGCCGCGTCGTGCGCGGGATGCCGGCCCGCCAGCGCGTGTACGAGGAGATCAAGGCGC
GCGCGTCGACCCGCTTCGCGCCGATGACGATCGCGCGCATCGTCGGCGAAGGCAACACGGGCCTCGTCGC
GGGCAGCTATGCGATCCCCGGCACGTTCACGCGCGAGGCGTGGTTCCAGTACGTGCAGCCGGCGATCCGC
GACGCCGCGACCAAGGAGCTGCAGGCGAAGGACTGGGTGCTGAACACCGCGTCGGCCGACGATCTGACGC
TCGAGGGCAGCCCCGAGCAGATCCAGAAGACGCTCGTCGCGATGTACAAGACCGAGTACGCGCAGCACTG
GCAGAAGTTCATGCAGGGCATCGCGGTGCAGGGCTTCGGCAACTTCACGCAGGCCGTCGATGCGATGAAC
AAGCTCGGCGACCCGCAGGATTCGCCGATCCGCAAGGTGCTCGAGACCGCGTACGACCAGACCTCGTGGG
ACAACCCGTCGCTCGCGAACGCGACGATCAGGAAGGCGCAGACGGGCGTCGTGAACTGGGTCAAGCAGTG
GTTCACGCGCCAGCCGGGCGGCCAGATCGCGGCGAACGTCGACATCAACGGCAATCCCGCCGACGTGCCG
ATGGGCCCGATCGGCCAGGAGTTCGTCGGGCTCGGCCGGATCGTCGCGACGCACGACGGCACGTCGATGC
TCAAGGGCTACATGGACACGCTGTCGAAGGTCCGCACGCGCTTTAACGTGATCAAGAACCAGGGCGACCC
CGGCCCCGGCGCGCGCCAGCTGATGCAGCAGACGCTCGACGGCAACGGCTCGGAGCTCGCCGATTCGCTG
AAGTTCGTCGACGAGCAGATGCTCACGGGCCTGACCGATTCGCAACGCAAGTCGCTGCGCCCGCTCCTCG
TGCGTCCGCTGATGCAGGCGTTCGCGGTCGTGATCCAGCCGGCGAGCGTCGAGGTGAACAAGGTGTGGAA
CGCGCAGGTGTACCAGCCGTTCCAGAACTCGCTCGCGAACAAGTATCCGTTCGCGGCGGGCGCGAAGGTC
GAAGCGGGCGCGGGCGAGATCGCGCAGGTGTTCGGCCCCGACGGCTCGATCGCGAAGTTCGTCGGCGCGA
CGCTCGGGCCGCTCGCAGTGCGCCGCGGCGACACGCTGTCCGCGCGCACCTGGGGCGACATGGGCCTCGC
GCTCACGCCGGATTTCACGAGCGGCTTCGCGCGCTGGGTCGCGCCGCTCGCGGGCGGCGCGGCGACGAGC
GCCGCCGGGTCGTCCGAACCGCAGACCGTGTTCCAGGTGCTGCCGCAGCCGAGCAGCGGCACGACCGAGT
ACACGATCGCGATCGACGGCCAGCAACTGCGTTACCGCAACACGCCGCCGCAATGGACGAACTTCGTGTG
GCCGAACCCGCAGGGCTCGCCCGGCGCGACGCTGTCCGCCACGACGTTCGACGGCCGTACGGTGCAGCTC
GTCAACGAGCCGGGCCGCTACGGTCTCGAGAAGCTGATCAACTCGGCGCAGCGCAAGCGCCGTGCGGACG
GCACGTTCGATCTGACGTGGACGCAAGGCAGCGTCAGCGTGTCGGTGACGATGCGCATCATCAGCACGTC
GCAGCCGACTGGCGGCGGCGGCGATCAGCCGCAGCAGCAGAGCCTGCGCGGCCTGCGCCTGCCGTCGTCG
GTCGCCGACGCGAGCGCGGGCGGCGCGGCCAACGCAACGGCGCAGCCCGGCTCGGGCGGCACGGCCGCGG
CCCCGCAGGCCGCCGTCGCGACGGCTTCCGCATCGAATGCACAGGGGGCGCAATGA
 Primer design