SecReT6
Protein ID: 84624548
SecReT6 ID116
T6SS typei3
Gene symbol-
Locus tagXOO_2891
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3263834..3267292 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ2P1D1
KEGG IDxom:XOO_2891
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.60E-88, Aligned region: 197..459
IcmF-related [PF06761], Evalue: 2.50E-68, Aligned region: 510..809
DUF1215 [PF06744], Evalue: 2.70E-26, Aligned region: 896..1017
AAA_16 [PF13191], Evalue: 0.0027, Aligned region: 68..120
AAA_16 [PF13191], Evalue: 0.0027, Aligned region: 117..261
AAA_16 [PF13191], Evalue: 0.0027, Aligned region: 544..578
AAA_16 [PF13191], Evalue: 0.0027, Aligned region: 777..840
Protein Sequence: 1152 a.a.     [Download]
>gi|84624548|ref|YP_451920.1| hypothetical protein XOO_2891 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MRFVLDFLRVRYLASAAILSLLAVLVWVGGPYLSLGRWQPFASVSGRLLAMAVLVLAWAGWRYLRWRRDS
AKQQRLAAELVGQGARAEDASGNDSRARAAQEQVRLRARFTEAMAVLRRRRRNGPGLHVLPWYLLIGAPG
SGKSTLLQSSGLEFPLKAHGTHAALEGVGGTRNCDWWFADQAVFLDSAGRYTTQDSDAIADAGAWHGFLD
LLRRHRRQPLNGVIVTVSVAELLELDGDAGLSHARAVRHRLNELVEKLRARVPVYLIVTKCDLVSGFAEF
FADLEAAGRAQVWGVSFPQAQAAGDTDPLTRFPTELERLLERIDQRVLEHLHRARDARERAAVLSFPQQL
RLLQPALMDVVQTAFGRHGYAGQPWLRGVYLSSGTQQGHPIDHVISAVARHFGVAAAGLPPVSSAPRSYF
LSRLLKDVVFAEAGLAGSQPGSAQRRRLLQLACWAVLTATTLGVLSGMAGSYARNVRLIGQVRDALDAYP
AGPLPADAGEAAFYAKALQRFDALAQARDAALPPGASIPWSRRFGLHQGTALARDVQEAYLRDLNGALLP
ALAQSLRRKLEQSSNDPQRLYPLLKGYLMLGDPTRRDAMHLATLAGTVWRQIFPDDASVRAGLNLHLRAL
LGPVDGGRALALDRQQIEQTRASLRTAELPALVYGGLKLTQPGVDAGQAPRLDRRLGLLSDVFERRSGLP
LSAPLPPLFTRQAFQAQIGGGIAHGVQQFLADDWVLGTAPLDPLARSQLEREVLALYQRDYIAAWDSLLA
DLVLRPVVQTGQASAVAAKLGGPASPLKALLVLLREHTHALGRTPAAKAGAGAAAAADTAAAAEPDVAAE
PIERHFEPLTRLLDGGPGASALDETLAALTQMSRTLLGAAAGVAADQNAPALLIAAQQAEQLPPPLGNWM
ATLSGRGRALTASSAGEALRNAQRQAAGRECALLVSGRFPFVPGSNNEIPLRDFAELFAPGGRMDRFAQQ
ALLGKVDTSGPGWKWNAGMAAAGADDVLARAQLADEIKQAFFVGGGAQPQVAFTVSIPPQAGIRRLQLEV
DGQALDVRDGARATQSMTWPGPTPGLVRLAAWDASGQALPVVEYRGPWAWFRVMQAGRLHRSGDLDYTAS
LALGGTSVRVDIQPASLRHPFAASAVQRFSCP
 
Nucleotide Sequence: 3459 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3267292-3263834 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGCGCTTTGTGCTCGATTTCCTGCGCGTCCGCTACCTCGCCAGCGCTGCCATCCTCAGTCTGTTGGCCG
TCCTGGTGTGGGTCGGCGGACCCTATCTCAGCCTGGGCCGCTGGCAGCCGTTTGCCAGCGTGAGCGGGCG
CCTGCTTGCCATGGCCGTACTGGTGCTCGCGTGGGCAGGGTGGCGCTATCTGCGCTGGCGCCGCGACAGC
GCCAAGCAGCAACGTCTGGCCGCCGAACTGGTCGGGCAGGGAGCACGTGCCGAAGACGCCAGCGGCAACG
ACAGTCGCGCGCGTGCAGCACAGGAGCAGGTCCGCCTGCGTGCGCGCTTTACCGAAGCCATGGCGGTGCT
GCGCCGTCGCCGTCGCAACGGTCCCGGCCTGCACGTGCTGCCCTGGTATCTGCTGATCGGCGCGCCCGGT
TCCGGCAAGAGCACCTTGCTGCAGTCTTCGGGCCTGGAGTTCCCCCTCAAGGCACATGGCACCCACGCCG
CGCTGGAAGGTGTCGGTGGCACGCGCAACTGCGATTGGTGGTTCGCCGACCAAGCAGTGTTCCTCGACAG
TGCCGGGCGCTATACCACTCAGGATTCGGACGCCATCGCCGATGCCGGTGCCTGGCATGGCTTTCTGGAC
CTGCTGCGGCGGCACCGCCGGCAGCCATTGAACGGCGTCATCGTGACCGTGAGCGTGGCCGAGCTGCTGG
AGCTCGATGGCGATGCCGGTCTGTCGCACGCGCGGGCAGTACGTCATCGACTGAACGAACTGGTCGAGAA
ACTGCGCGCACGCGTGCCGGTCTACCTGATCGTGACCAAATGCGATCTGGTGTCGGGCTTCGCCGAATTC
TTCGCCGATCTGGAGGCCGCCGGCCGCGCGCAGGTGTGGGGGGTGTCGTTCCCACAGGCGCAGGCCGCCG
GTGACACCGATCCGTTGACGCGATTCCCCACCGAGCTCGAACGCCTGCTGGAGCGGATCGATCAGCGCGT
GCTGGAGCACCTGCATCGGGCGCGCGATGCACGCGAGCGTGCCGCGGTGCTGTCCTTTCCGCAGCAATTG
CGGTTGCTTCAGCCAGCGCTGATGGACGTCGTGCAGACCGCGTTCGGCCGCCATGGCTATGCCGGCCAGC
CGTGGCTGCGTGGTGTCTATCTGAGCTCGGGGACGCAGCAAGGCCATCCGATCGACCACGTCATCTCGGC
AGTGGCGCGACACTTCGGTGTTGCCGCCGCCGGTCTGCCGCCCGTCAGCAGCGCACCACGCAGTTACTTC
CTGTCACGCCTGCTCAAGGACGTTGTCTTCGCCGAGGCGGGACTGGCCGGCAGCCAACCCGGCAGCGCGC
AGCGCCGTCGGTTGCTGCAGCTGGCCTGCTGGGCCGTGTTGACCGCCACCACCCTGGGCGTGCTGTCGGG
CATGGCCGGCAGTTACGCCCGCAACGTGCGGCTGATCGGGCAGGTGCGCGACGCGCTCGATGCCTATCCC
GCCGGCCCGCTGCCCGCCGATGCAGGCGAGGCGGCCTTCTATGCCAAAGCCTTGCAGCGTTTCGACGCAT
TGGCGCAGGCGCGCGATGCGGCGTTGCCGCCGGGCGCGTCGATTCCGTGGTCGCGACGTTTCGGGCTGCA
CCAGGGCACGGCCTTGGCGCGCGATGTGCAAGAAGCGTATCTGCGCGACCTCAATGGCGCGTTGCTGCCG
GCATTGGCGCAATCGCTGCGACGCAAGCTGGAGCAGTCCAGCAACGATCCGCAACGTCTGTATCCATTGT
TGAAGGGCTATCTGATGCTGGGAGACCCGACACGGCGCGATGCAATGCATCTGGCCACGCTGGCAGGCAC
GGTCTGGCGCCAGATATTTCCCGACGATGCATCGGTGCGTGCAGGGTTGAACCTGCATCTGCGCGCCTTG
CTGGGTCCGGTGGACGGCGGGCGCGCGCTTGCGCTGGATCGGCAGCAGATCGAGCAGACACGGGCGAGCC
TGCGAACCGCCGAACTGCCGGCACTGGTCTACGGTGGCCTCAAGCTGACGCAGCCCGGGGTCGATGCCGG
CCAGGCCCCACGCCTGGATCGCCGCCTGGGCCTGCTGAGTGATGTCTTCGAACGCCGCAGTGGCCTGCCG
TTGTCTGCGCCATTGCCCCCGCTGTTCACCCGTCAAGCGTTTCAAGCACAGATCGGCGGTGGCATCGCGC
ATGGCGTGCAGCAGTTTCTCGCCGACGATTGGGTGTTGGGCACGGCACCGCTGGACCCGTTGGCGCGCTC
GCAACTGGAGCGCGAGGTATTGGCGCTGTATCAGCGCGACTACATCGCCGCCTGGGACAGCCTGCTGGCC
GATCTGGTGTTGCGGCCGGTCGTGCAGACCGGGCAGGCGAGTGCGGTGGCCGCCAAGCTGGGTGGACCGG
CATCGCCGCTGAAGGCGTTGCTGGTGTTGCTGCGCGAGCACACCCACGCACTGGGGCGCACGCCTGCAGC
GAAGGCCGGCGCGGGCGCTGCAGCTGCCGCGGACACTGCTGCTGCGGCCGAGCCGGATGTGGCAGCCGAA
CCGATCGAACGCCATTTCGAGCCGCTCACTCGCCTGCTCGATGGTGGGCCGGGCGCCAGTGCGCTGGACG
AAACCCTGGCCGCGCTGACCCAGATGAGCCGCACGCTGTTGGGAGCCGCCGCTGGCGTGGCTGCCGACCA
GAACGCCCCAGCGTTGCTGATCGCCGCGCAACAGGCCGAACAGCTGCCGCCGCCGCTGGGCAACTGGATG
GCGACCTTGTCCGGTCGTGGTCGCGCATTGACCGCCAGCAGCGCCGGCGAAGCATTGCGTAACGCGCAAC
GGCAAGCCGCCGGGCGTGAGTGCGCGCTGCTGGTGAGCGGGCGTTTCCCGTTCGTGCCGGGCAGCAACAA
CGAGATCCCGCTGCGCGATTTCGCCGAACTGTTCGCACCCGGTGGGCGGATGGACCGGTTCGCGCAACAG
GCGTTGCTCGGCAAGGTCGATACCAGCGGGCCTGGCTGGAAATGGAATGCAGGCATGGCTGCGGCTGGCG
CAGACGACGTGCTGGCGCGCGCGCAACTGGCCGACGAGATCAAGCAAGCATTCTTCGTCGGCGGCGGTGC
GCAGCCGCAGGTCGCCTTCACTGTTTCCATTCCACCGCAAGCAGGGATTCGCCGGCTGCAGCTGGAGGTG
GATGGGCAAGCGCTGGACGTGCGCGATGGTGCGCGCGCCACCCAGTCGATGACCTGGCCTGGTCCAACGC
CCGGTCTGGTGCGTCTGGCGGCGTGGGACGCCAGCGGACAGGCTTTGCCAGTGGTCGAATACCGCGGCCC
CTGGGCCTGGTTTCGGGTCATGCAGGCCGGGCGGCTGCACCGCAGCGGCGATCTGGATTACACCGCCAGC
CTCGCGCTGGGCGGCACCAGCGTGCGCGTGGACATACAACCGGCCAGCCTGCGGCATCCCTTTGCGGCGT
CGGCCGTGCAGCGGTTCAGTTGCCCATGA
 Primer design