SecReT6
Protein ID: 84624976
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3319
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3781210..3784902 [-]
Producttransmembrane protein
NoteTssM
UniProt IDQ2P053
KEGG IDxom:XOO_3319
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.80E-74, Aligned region: 173..434
ImcF-related_N [PF14331], Evalue: 1.80E-74, Aligned region: 923..981
IcmF-related [PF06761], Evalue: 2.10E-48, Aligned region: 478..817
DUF1215 [PF06744], Evalue: 5.60E-25, Aligned region: 759..779
DUF1215 [PF06744], Evalue: 5.60E-25, Aligned region: 797..797
DUF1215 [PF06744], Evalue: 5.60E-25, Aligned region: 941..1056
DUF3007 [PF11460], Evalue: 0.002, Aligned region: 2..46
DUF3007 [PF11460], Evalue: 0.002, Aligned region: 433..481
DUF4446 [PF14584], Evalue: 0.0063, Aligned region: 27..92
DUF4446 [PF14584], Evalue: 0.0063, Aligned region: 433..477
DUF4446 [PF14584], Evalue: 0.0063, Aligned region: 882..935
Protein Sequence: 1230 a.a.     [Download]
>gi|84624976|ref|YP_452348.1| transmembrane protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MILGLLAAAAVAYFGTEGLREIGLWAAAVLVVCLTIWLLVWIVRRIIARRAARSLDAMVQGEADRAVAAA
QPANRADTEALRSRMLEAVKAIKSSRLGVLKGKAALYELPWYVIIGNPAAGKSTAILNSGLQFPFEDNRG
NVIQGIGGTRNCDWYFTMTGIVLDTAGRYSVSVEDRLEWLTFLALLKKHRPRAPINGIIIAASIAELSGS
KPEFAIELAKNLRQRVQEITQRLEVFAPVYVVFTKADLIAGFSEFFHNLDPSERENVWGATLPYDPTANT
DALAAFDTHFDELAEGLKEMSLAHMAMQRGRQVSPGLLTLPLEFVGIKPALRTFIATLFEENPYQFKPVF
RGFYFSSALQEGHSVHHASERVSRQFALQARAQSGEAVPSGQTAYFLKDLFRKVIFTDKQLVRQYSSPHQ
NRLRYGVFLGGVAVLALALGLWTWSYTTNVQLVNNATKDLDQAVRVQANRVDLQSRIDALLLLQDRLEQL
DRYKQKGGITSGLGLYQGGNIRKKLLAEYYNGMRQVMLEPTTANLESFLGQVVSERDRLGKAAGPQQAAQ
QDSVLYQDASPTDTNDAYNALKTYLMLGNRKHVESAHLTQQLTLFWRGWLDANRGQMTREEMTRAAEKLM
TFYVAQAEDPQWPQVQTKVTLVNDSREALTRVMKGQPAMQRVFAQIKARAAARFPTVTVNALIGEEANSG
AITGSYAISGAFSREAWEEYVKDAIKEAANTQLSTTDWVLDTSEQSDLSLAGSPEHVARELVTAYKQEYA
KEWRKFIQGISVAPFHGFDQALSRMNRIGDPANSPLRKLLEKIDEQTIWDNPMADALSKKASGGVVAWFQ
RVILRRDPAEAGKAEQQPVGPIGKTFEGLARLMTKRTDQPAVIDAYFDKLAKLRTRMNAIKNQGQIGVGA
RKLMQDTFSNEGSELSAALTLVDEQMLTGLDETQRDAMRPLLLRPLTQTFAALVPPTENEINRVWAAQVY
EPFRNGIGQRYPFNLNTDVDAAPGDVAAIFGASGAIAAFNKDALGTLVIQRGNLLESRRWAGIGITLSSE
LVANYGNWVSGQSGAVAKDVSIFELLPTPAVGAIEYTIDISGQTLRYRNTPPQWMTMQWPNAGAVPGAKI
TAVTSDGRSVEMFNAPGDNGLGRLIKAAAQEPVDDATRRFTWSDQGVSISVQMRIVQSAGKATGGGDWQR
GLQLPATVAGSPTTVGADAPAAAAPPGSVPAGASAQEGGQ
 
Nucleotide Sequence: 3693 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3784902-3781210 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGATTCTCGGCTTGCTCGCCGCCGCCGCAGTCGCCTACTTCGGCACCGAGGGCTTGCGCGAAATTGGCC
TGTGGGCGGCGGCGGTGCTGGTGGTCTGTCTGACGATATGGCTGCTGGTGTGGATCGTGCGCCGGATCAT
CGCGCGCCGCGCTGCGCGCAGCCTGGATGCGATGGTGCAAGGCGAAGCCGATCGCGCGGTCGCCGCCGCG
CAGCCGGCCAACCGCGCCGACACCGAAGCGCTGCGCTCGCGCATGTTAGAGGCGGTCAAGGCGATCAAGT
CCTCGCGCCTGGGCGTGCTCAAGGGCAAGGCGGCGCTGTACGAACTGCCGTGGTACGTGATCATTGGCAA
TCCTGCGGCTGGCAAGAGCACCGCGATCCTCAATTCCGGGTTGCAGTTCCCGTTCGAGGACAATCGCGGC
AACGTGATCCAGGGCATCGGTGGCACGCGCAATTGCGATTGGTACTTCACCATGACCGGTATCGTGCTTG
ATACCGCCGGTCGGTATTCGGTCAGTGTCGAAGACCGCCTGGAATGGCTCACCTTTCTCGCGCTGCTGAA
AAAGCACCGGCCGCGCGCGCCGATCAACGGCATCATCATCGCCGCCAGCATCGCCGAACTGTCCGGTAGC
AAGCCCGAGTTCGCGATCGAGCTGGCCAAGAACCTGCGCCAGCGCGTGCAGGAAATCACCCAGCGCCTGG
AAGTGTTCGCGCCGGTGTACGTGGTGTTTACCAAGGCCGACCTGATCGCCGGCTTCTCCGAATTCTTCCA
CAATCTGGATCCGTCCGAGCGCGAGAACGTGTGGGGTGCGACCCTGCCCTACGATCCGACCGCCAATACC
GATGCGCTGGCCGCCTTCGACACTCATTTCGACGAACTGGCCGAAGGCCTCAAGGAAATGAGCCTGGCGC
ACATGGCGATGCAGCGTGGGCGTCAGGTGTCGCCGGGCCTGCTGACACTGCCGCTGGAGTTCGTCGGCAT
CAAACCGGCGCTGCGCACCTTCATCGCCACGCTGTTCGAAGAAAACCCCTATCAGTTCAAGCCGGTGTTC
CGCGGTTTCTACTTCAGCAGCGCGTTGCAGGAAGGCCATTCCGTGCACCACGCCTCCGAGCGGGTGAGCC
GCCAGTTCGCGCTGCAGGCGCGTGCGCAATCCGGCGAAGCGGTGCCGTCGGGACAGACCGCTTACTTCCT
GAAAGACCTGTTCCGCAAGGTCATCTTCACCGACAAACAGCTCGTCCGGCAGTACTCCAGCCCGCACCAG
AACCGCCTGCGCTACGGCGTCTTCCTCGGTGGCGTCGCCGTGCTGGCGTTGGCGCTGGGTCTGTGGACCT
GGTCGTACACCACCAACGTGCAACTGGTGAACAACGCCACCAAGGATCTGGATCAGGCCGTGCGCGTGCA
GGCCAACCGGGTCGACTTGCAATCGCGCATCGACGCGCTGCTGCTGTTGCAGGATCGGCTCGAGCAGCTG
GACCGCTACAAGCAAAAGGGCGGCATCACCTCCGGGCTGGGCCTGTACCAGGGCGGCAACATCCGCAAGA
AGCTGCTGGCCGAGTACTACAACGGCATGCGCCAGGTGATGCTTGAGCCGACCACCGCCAATCTGGAGTC
GTTCCTGGGGCAAGTGGTCAGCGAGCGCGACAGGCTCGGCAAGGCGGCCGGCCCGCAGCAGGCCGCGCAG
CAAGACAGCGTGCTGTATCAGGACGCGTCGCCGACCGATACCAACGACGCCTACAACGCGCTGAAGACCT
ACCTGATGCTGGGCAACCGCAAGCACGTGGAGAGCGCGCACCTGACGCAGCAGCTGACCCTGTTCTGGCG
CGGCTGGCTGGACGCCAATCGCGGCCAGATGACCCGCGAGGAGATGACCCGCGCGGCCGAGAAGCTGATG
ACGTTCTACGTCGCCCAGGCCGAAGATCCGCAGTGGCCGCAGGTGCAGACCAAGGTCACCCTGGTCAACG
ACAGCCGCGAGGCGCTGACCCGGGTGATGAAGGGCCAGCCGGCGATGCAACGCGTGTTCGCGCAGATCAA
GGCGCGCGCGGCGGCGCGCTTCCCCACGGTGACGGTCAACGCGCTGATCGGCGAGGAAGCCAACAGCGGC
GCGATCACCGGCAGCTATGCCATTTCCGGGGCGTTCTCGCGCGAGGCGTGGGAAGAATACGTCAAGGACG
CGATCAAGGAAGCGGCCAATACGCAGCTCAGCACCACCGACTGGGTCCTGGACACGAGCGAGCAGAGCGA
CCTGTCGCTGGCCGGCAGCCCTGAGCACGTCGCGCGCGAACTGGTGACGGCGTACAAGCAGGAATACGCC
AAGGAGTGGCGCAAGTTCATCCAGGGGATCAGCGTGGCGCCGTTCCATGGCTTCGACCAGGCGCTGTCGC
GGATGAATCGCATCGGCGATCCGGCCAACTCGCCGTTGCGCAAGCTGCTGGAAAAGATCGACGAGCAGAC
CATCTGGGACAACCCGATGGCCGACGCCTTATCGAAGAAGGCGTCCGGCGGGGTCGTCGCCTGGTTCCAG
CGGGTGATCCTGCGCCGCGATCCGGCCGAAGCCGGCAAAGCTGAGCAGCAGCCGGTCGGCCCGATCGGCA
AGACCTTCGAGGGCCTGGCGCGGCTGATGACCAAGCGCACGGACCAGCCGGCGGTCATTGATGCCTACTT
CGACAAGTTGGCCAAGTTGCGCACGCGCATGAACGCGATCAAGAACCAGGGCCAGATCGGCGTCGGCGCG
CGCAAGCTGATGCAGGACACCTTCAGCAACGAAGGCTCCGAACTCAGCGCCGCGCTGACCCTGGTGGACG
AGCAGATGCTGACCGGGCTGGATGAAACCCAGCGCGACGCGATGCGTCCGCTGTTGCTGCGTCCGTTGAC
CCAGACCTTCGCCGCGCTGGTGCCGCCGACTGAGAACGAGATCAACCGGGTGTGGGCGGCGCAGGTCTAC
GAACCGTTCCGTAACGGCATCGGCCAGCGCTATCCGTTCAACCTCAACACGGACGTGGATGCCGCCCCCG
GCGACGTGGCTGCGATCTTCGGCGCCAGCGGCGCGATCGCCGCGTTCAACAAGGACGCACTCGGCACCTT
GGTGATCCAGCGCGGCAACCTGCTCGAATCGCGGCGTTGGGCGGGCATCGGCATCACCTTGTCCAGCGAA
CTGGTGGCCAACTACGGCAACTGGGTCAGCGGCCAGTCCGGCGCGGTGGCCAAGGACGTCAGCATCTTCG
AGCTCCTGCCGACGCCGGCGGTAGGCGCGATCGAATACACCATCGACATCTCTGGCCAGACGCTGCGCTA
CCGCAACACCCCGCCGCAGTGGATGACCATGCAGTGGCCGAACGCCGGTGCGGTGCCCGGTGCCAAGATC
ACCGCGGTCACCAGCGACGGGCGCAGCGTCGAGATGTTCAATGCGCCTGGCGACAATGGCCTTGGCCGCT
TGATCAAGGCAGCCGCCCAGGAACCCGTGGACGATGCCACCCGTCGCTTCACCTGGAGCGACCAAGGCGT
GTCCATCAGCGTGCAGATGCGCATCGTGCAGAGTGCCGGCAAGGCTACCGGGGGGGGGGACTGGCAGCGT
GGCCTGCAACTTCCGGCGACGGTGGCCGGTAGCCCGACAACCGTCGGTGCCGATGCGCCAGCGGCCGCTG
CGCCGCCCGGTTCGGTTCCGGCGGGTGCGTCCGCACAAGAAGGTGGCCAATGA
 Primer design