SecReT6
Protein ID: 89055526
SecReT6 ID118
T6SS typei5
Gene symbol-
Locus tagJann_3035
StrainJannaschia sp. CCS1
Repliconchromosome [GenBank: NC_007802] [Browse all T6SS(s) in this replicon]
Location [Strand]3057900..3061373 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ28MW0
KEGG IDjan:Jann_3035
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.00E-76, Aligned region: 98..129
ImcF-related_N [PF14331], Evalue: 1.00E-76, Aligned region: 204..454
IcmF-related [PF06761], Evalue: 1.50E-63, Aligned region: 506..807
IcmF-related [PF06761], Evalue: 1.50E-63, Aligned region: 857..905
IcmF-related [PF06761], Evalue: 1.50E-63, Aligned region: 988..1013
DUF1215 [PF06744], Evalue: 8.70E-31, Aligned region: 896..1017
AAA_28 [PF13521], Evalue: 0.0075, Aligned region: 140..154
AAA_28 [PF13521], Evalue: 0.0075, Aligned region: 178..267
AAA_28 [PF13521], Evalue: 0.0075, Aligned region: 892..957
Protein Sequence: 1157 a.a.     [Download]
>gi|89055526|ref|YP_510977.1| unnamed protein product [Jannaschia sp. CCS1]
MNPLGMWTTIRSNVQSYASVLGPRFAALIWVGAICAVIWIFGPRLPWGDTRPLEPARIRLILIAVILGLW
LIYALISWLRGRKRAASEDAAITESPEAVAAGEAREEIAELRSRLRDALKMMRKHARRRFGYAYDFPWYL
MMGAPGAGKTTLLQRSGLKFPLGDALRAEPVQGVGGTRNCNWWFTDRAILIDTAGRYTTQETGQARDREG
FLGFLSMLRRTRRQQPINGIVLTLSLTDLLAQDPEDRLRDIRAIRQRLTETEEALGARIPVYMVLTKADR
LTGFSRFFDSLGQQARKQVWGITFPYEEAQTKGTLPDIFSREYQGLLARLNAMLIERFQQETDIDQRGRI
FRFPAQVSALHDALREIVEELSSGAANVSEPLLRGIYFASATQENAGPVAAIPGVPQTAAAMNRTYFVER
LFREVILGEAALVGRDARVSRRRRIATGLAYGAAASLALFLLGSWTLGFSTNRQALAAIDTGLVNYEDLA
DTIPVRDVADADFLRVLPALDRLARTPDAFHVAEGPGLTMRRASFGMDRSARIESGHAEAYSEALGAFLL
PRYMVALQNVLQDGETDEATAFETLKHYLSLAGLGPIDRDGLLAQSERLFDQLYPGSGRGPTRDALQAHM
VAMLDRGTLPVLEIDEMLVEDTRARIAERSPAQRVLDLLADRPAARAIPDWTLTSAAGPRARQVFVGDGT
VIDGLYTRAGYREVLLPRIGALSEVAVHEDWVRGPGTPTRATPSDIAADAVTLYYAAFESHWRAALSGLS
IVPTEALSGAADLALTLASEADPLSRLARDIAARTDLITPSPIDDFDASALPFDPATAPDPYGPLRRSLE
PEEDAEGNTTDALTPLVPLYDEIYQQLTRLDSPDPAAAAALASETALRDAAQSLVAEGRQLDAPIDAFVV
TIAARVSEAAVGQARAAADALWQAEGYPMCDRAISDRYPFSPAASADVTLTDFTAVFGPNGLFATFFAEH
LADLVNTTADPWVWSGGLAPDGDIQTALHQFQRAAQIRAAFFPNGVAEPRVELRVDLIALEQGARVALFE
IGDRRSAHREDLSDEERLIWPPEDSDIARVMLLPGDRETAPTERGPWAPFRLIDRAEVTPGTDNEFQARF
TVDGRAVTFNLTSGSVNNPFNLPALTAFRCPQSLAAQ
 
Nucleotide Sequence: 3474 bp     [Download]
>gi|89052491|ref|NC_007802.1|:3057900-3061373 Jannaschia sp. CCS1 chromosome, complete genome
ATGAACCCCCTTGGCATGTGGACCACGATCCGCTCAAACGTCCAGTCCTACGCCTCTGTGCTTGGACCGC
GCTTTGCGGCGCTGATCTGGGTCGGCGCGATCTGCGCCGTGATCTGGATCTTCGGCCCCCGTCTGCCCTG
GGGCGACACGCGCCCGCTGGAGCCCGCCCGCATCCGTCTGATCCTGATTGCAGTGATCCTTGGTCTCTGG
CTGATTTATGCGCTGATTTCCTGGCTGCGCGGACGCAAACGCGCCGCGTCTGAGGACGCAGCCATCACCG
AAAGCCCCGAGGCGGTCGCCGCCGGCGAGGCCCGGGAAGAGATTGCGGAACTCCGCTCCCGTCTGCGCGA
TGCCCTCAAGATGATGCGCAAACACGCGCGGCGGCGGTTTGGCTATGCCTATGACTTTCCATGGTATTTG
ATGATGGGCGCGCCCGGGGCGGGCAAGACGACGCTGCTGCAACGCTCGGGCCTGAAGTTCCCCCTCGGCG
ATGCGTTGCGGGCAGAGCCGGTGCAGGGCGTGGGCGGGACGCGCAATTGCAACTGGTGGTTCACCGACCG
CGCCATCCTGATCGATACCGCCGGGCGCTATACCACGCAGGAAACCGGACAGGCCCGCGACCGCGAAGGG
TTTTTGGGATTTTTATCGATGCTGCGCCGCACCCGTCGACAGCAGCCGATCAACGGCATCGTGCTGACCC
TGTCGCTGACGGACCTTCTGGCCCAGGACCCCGAAGATCGCCTGCGCGACATCCGCGCCATCCGCCAGCG
CCTGACCGAGACGGAAGAGGCGCTTGGCGCGCGCATTCCGGTTTATATGGTGTTGACCAAGGCCGATCGT
CTGACCGGGTTTTCGCGCTTTTTCGATAGTCTCGGCCAGCAGGCGCGCAAGCAAGTCTGGGGCATCACCT
TTCCATATGAGGAGGCGCAGACAAAAGGCACCCTCCCCGACATTTTCAGCCGCGAATATCAGGGGCTTCT
GGCACGCTTGAATGCGATGCTGATCGAGCGGTTTCAGCAGGAAACCGACATCGACCAGCGCGGGCGTATC
TTCCGGTTTCCCGCCCAGGTCAGCGCGCTCCATGATGCCCTGCGCGAGATTGTGGAAGAGCTGTCATCGG
GGGCCGCAAATGTGTCCGAGCCGTTGTTGCGCGGCATCTACTTTGCCTCCGCCACGCAGGAAAACGCAGG
TCCCGTCGCCGCCATCCCAGGCGTGCCTCAAACCGCCGCCGCGATGAACCGCACCTATTTCGTGGAGCGG
TTATTCCGCGAAGTGATCCTGGGAGAGGCCGCGCTGGTGGGCCGCGACGCCCGCGTCAGCCGCCGTCGCC
GCATTGCGACCGGCCTGGCCTACGGGGCCGCGGCATCCTTGGCACTGTTCCTGCTTGGCAGCTGGACCCT
TGGCTTCAGCACCAACCGGCAGGCGTTGGCCGCCATTGATACTGGTCTCGTGAATTACGAAGATCTGGCC
GACACGATCCCCGTGCGCGACGTGGCCGACGCCGATTTCCTGCGCGTCCTGCCTGCCCTTGACCGTCTGG
CGCGGACGCCGGACGCCTTTCACGTGGCAGAGGGGCCGGGCCTGACCATGCGCCGCGCCAGCTTTGGCAT
GGACCGCTCCGCCCGGATCGAGTCTGGCCACGCGGAGGCCTATTCCGAGGCGCTCGGCGCGTTCCTGCTG
CCCCGCTACATGGTCGCCCTGCAAAACGTGCTGCAAGACGGCGAAACCGACGAAGCCACTGCGTTCGAGA
CCTTGAAGCATTACCTTTCGCTCGCCGGGCTGGGGCCGATTGATCGCGACGGTCTTCTGGCCCAATCGGA
ACGTCTGTTTGACCAGCTTTACCCCGGCTCCGGGCGCGGGCCCACGCGCGACGCCCTGCAAGCGCATATG
GTCGCCATGCTGGATCGCGGCACCCTTCCGGTGCTGGAAATTGACGAGATGCTGGTGGAAGACACCCGCG
CCCGCATCGCCGAACGCAGCCCCGCCCAACGTGTGCTGGATCTGCTGGCCGACCGCCCCGCTGCCCGCGC
CATTCCCGACTGGACGCTCACCTCTGCCGCCGGGCCCCGGGCGCGTCAGGTGTTTGTGGGCGACGGCACC
GTGATCGACGGGCTCTATACCCGCGCGGGCTACCGTGAGGTTCTTCTGCCCCGCATCGGGGCCCTGTCCG
AAGTCGCTGTGCATGAGGATTGGGTCCGCGGACCCGGCACGCCCACCCGTGCCACGCCGTCCGATATCGC
CGCCGATGCGGTGACGCTCTACTATGCCGCCTTTGAAAGCCATTGGCGCGCGGCGCTCAGTGGATTGTCC
ATCGTGCCGACCGAGGCCCTGTCCGGTGCGGCGGATCTTGCCCTGACCCTCGCGTCCGAGGCAGATCCCC
TCAGCCGTCTGGCCCGCGACATCGCCGCGCGCACCGACCTGATAACCCCGTCGCCCATCGATGATTTCGA
CGCCTCGGCCCTGCCCTTCGATCCGGCCACTGCCCCGGACCCCTACGGCCCCCTGCGCCGGTCACTGGAG
CCCGAGGAGGACGCCGAAGGCAACACAACGGACGCCCTTACTCCGCTGGTCCCCCTCTATGACGAGATCT
ACCAGCAGCTCACCCGGCTGGATTCGCCTGATCCCGCCGCCGCCGCAGCACTGGCATCTGAGACCGCCTT
GCGGGATGCCGCGCAATCGCTGGTGGCCGAGGGGCGGCAGCTGGATGCCCCCATCGACGCCTTCGTCGTC
ACCATCGCCGCCCGTGTATCCGAGGCCGCCGTGGGTCAGGCCCGCGCCGCCGCCGATGCGCTGTGGCAGG
CCGAGGGCTACCCGATGTGTGACCGTGCCATCTCGGACCGCTATCCCTTCAGCCCCGCCGCCTCTGCCGA
TGTGACGCTGACTGATTTCACCGCTGTCTTCGGCCCAAATGGCCTCTTTGCCACCTTCTTCGCCGAGCAT
CTCGCTGACCTCGTCAACACCACCGCCGATCCCTGGGTCTGGTCCGGGGGTCTTGCGCCCGATGGCGACA
TCCAGACCGCCCTGCACCAGTTTCAGCGCGCCGCCCAGATCCGCGCCGCCTTCTTCCCCAATGGCGTGGC
CGAACCGCGGGTGGAACTGCGCGTGGACCTTATCGCTCTGGAACAGGGCGCGCGGGTGGCGCTGTTTGAA
ATCGGTGATCGCAGGTCAGCCCACCGCGAAGATCTGTCCGATGAAGAACGCCTGATCTGGCCGCCCGAGG
ATTCTGACATCGCCCGCGTCATGCTGCTGCCCGGGGACCGGGAAACCGCCCCCACGGAACGCGGCCCCTG
GGCCCCCTTCCGCCTGATCGACCGCGCCGAAGTGACCCCCGGCACCGACAACGAATTTCAGGCGCGCTTC
ACCGTCGATGGCCGTGCGGTGACATTCAACCTGACCTCGGGCAGCGTGAACAACCCGTTCAACCTGCCCG
CGTTGACGGCGTTCCGCTGTCCCCAATCTCTCGCGGCCCAATGA
 Primer design