SecReT6
Protein ID: 90021169
SecReT6 ID119
T6SS typei5
Gene symbol-
Locus tagSde_1522
StrainSaccharophagus degradans 2-40
Repliconchromosome [GenBank: NC_007912] [Browse all T6SS(s) in this replicon]
Location [Strand]1960893..1964438 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ21KJ5
KEGG IDsde:Sde_1522
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.30E-84, Aligned region: 311..343
IcmF-related [PF06761], Evalue: 6.30E-84, Aligned region: 505..808
ImcF-related_N [PF14331], Evalue: 3.00E-80, Aligned region: 195..449
DUF1215 [PF06744], Evalue: 8.90E-35, Aligned region: 549..564
DUF1215 [PF06744], Evalue: 8.90E-35, Aligned region: 606..634
DUF1215 [PF06744], Evalue: 8.90E-35, Aligned region: 921..1040
Caa3_CtaG [PF09678], Evalue: 0.0038, Aligned region: 2..59
Protein Sequence: 1181 a.a.     [Download]
>gi|90021169|ref|YP_526996.1| unnamed protein product [Saccharophagus degradans 2-40]
MKRFFQQFTQPWFLSLLGVLLLCLIIWYIGPLIAIAEYKPLSAEWVRLSMVFVALILWGLNNLRKRTRTN
QATDKLANAIAEDAKPAASKTKKVPSADEQILESNLQKSLGLLQGSGFGKDNKLYKLPWYMVIGAPGSGK
TTALKNSGLNFPLQNKLGDAPIQGEGGTRYCDWWFTEEAILIDTAGRYTTQDNPQTKDSEAWLGFLARLK
KARPKQPLNGIIVTVSIQDILQKTPTQKALQATAIKQRVQELNNHLNMKIPVYLVLSKLDMVAGFNSFFS
DLEAQDREQAWGFTYSQFKAGDISATEEVFNNEFDLLLQRLEDRVLSRLNNEHSPQKRALIYEFPRQMRA
LKTEILKFVAPIFTPNQFETPIMWRGLYLLSSTQSNMASRWVTGILPPEQCAPPIDIIGIQPKTYFVNNL
LKKVIFAEANLATLNDKMRARYRWIYTGLTGCAIAAFSCLAIAWSHSKTLNKDYIHEIEDQLEKYSKIDK
KQNTAVRDWHNLALKLNLLRDLPTGYMLKDSQYTFKQGFGLYQGNKLGEQAETTYKKALESFFMQHLEEM
LGEQLELAKNDDERLYEALKFYLMPYHSSKMDTDSFTLWVNILWERQLPNQNKQVLLSELNSHLKTALSE
KVSPFPIDDTKVEMARNILIKTPLDLRVYRRLKNDYMDLHPEEFSIKSVLGKKADAMFYRKSGKALENGI
PELFTYSGFHRGFNLENIKLSQRLADEQWIYGDKQEEALTEERIKEISSRVNQYYFNEYIARWDEYLNDV
AIQSFGTVNRGQSVVQMLASSDQPLVKLLVQIRKHTALSEAPVISDNMKDSANQLAEEFSSSQKGRLERL
VPKSAGLSNIKLPGFDVTEHFEDLNSYINTEEGLPLLQLQQALINLDDYFQNLAYSENTKQAAFDASKEW
KGGSSPVVFVQRAISDAPPQIETWFSSIARDTAQVTAAATQSHMNNIWQTEVVSFYNRAIKDKYPLNPKS
KRDVKLADFTKFFGPAGILDSYFVEYIEPFVDTSKHPWRWKKNIGLSTNSLELFYQAQNIKNAYFSDKSG
EPEVAFSMKPHTLDHIASGFLLETAGTTIAYNHGPVRNVNVLWPGAKTDLSKIVFSLSSKGTPISARTEG
EWSWFRLLDEHSKIERKKESDGLLVTFELDGIASAYIIQPASTDNPYHNKDVQKFSLPTQL
 
Nucleotide Sequence: 3546 bp     [Download]
>gi|90019649|ref|NC_007912.1|:c1964438-1960893 Saccharophagus degradans 2-40 chromosome, complete genome
TTGAAACGTTTTTTCCAACAATTTACCCAGCCCTGGTTTCTTTCTCTTTTGGGCGTACTTTTGCTGTGCT
TGATTATTTGGTACATAGGGCCACTTATAGCAATTGCAGAGTACAAACCACTTAGCGCCGAGTGGGTAAG
ATTAAGCATGGTATTTGTTGCCCTTATACTTTGGGGCTTAAATAATTTACGTAAGAGAACCAGAACAAAC
CAAGCCACAGATAAATTGGCAAATGCTATTGCGGAAGATGCCAAGCCAGCTGCTAGCAAAACCAAGAAGG
TACCATCGGCCGATGAACAAATTTTAGAATCCAACCTTCAAAAAAGCCTTGGCTTGCTACAAGGTAGTGG
CTTTGGCAAAGACAATAAACTGTATAAGCTGCCATGGTATATGGTAATCGGCGCCCCAGGCTCAGGAAAA
ACCACAGCGTTAAAGAATTCTGGCCTTAACTTCCCGCTGCAAAATAAACTTGGCGACGCCCCCATTCAAG
GCGAAGGCGGCACACGCTACTGCGACTGGTGGTTTACCGAGGAAGCCATATTAATTGACACCGCCGGCAG
GTACACCACGCAAGACAACCCACAAACTAAAGACAGTGAAGCGTGGCTTGGCTTTTTAGCGCGCCTTAAA
AAAGCGAGACCCAAGCAACCCTTAAACGGCATAATTGTTACTGTAAGCATACAGGATATTCTGCAAAAGA
CGCCCACTCAAAAAGCTTTACAAGCAACGGCAATAAAGCAGCGCGTACAAGAGCTCAACAATCATTTAAA
CATGAAAATACCGGTGTATTTGGTATTAAGCAAACTCGACATGGTTGCAGGCTTTAACAGCTTTTTCTCT
GATTTAGAAGCGCAAGACAGAGAACAAGCATGGGGGTTTACCTACAGCCAGTTCAAAGCGGGCGATATTT
CTGCTACTGAAGAAGTGTTTAACAATGAATTTGATTTACTACTACAACGCCTTGAAGACCGTGTGCTATC
TCGGCTAAATAATGAGCACAGCCCACAAAAGCGTGCATTAATCTACGAGTTCCCTCGTCAGATGCGCGCA
CTTAAAACTGAGATTCTTAAGTTTGTAGCCCCTATTTTTACCCCCAATCAATTTGAAACCCCTATTATGT
GGCGCGGCTTATACCTGCTTAGTAGCACGCAGAGCAATATGGCTTCGCGCTGGGTAACAGGTATTTTACC
CCCAGAACAATGCGCGCCCCCAATTGACATAATTGGCATTCAACCTAAAACCTATTTCGTTAATAACTTA
CTTAAAAAAGTTATCTTTGCTGAGGCCAACCTAGCAACACTAAACGACAAAATGCGCGCTCGTTACCGCT
GGATATACACTGGCCTAACAGGCTGTGCTATTGCTGCTTTTTCTTGCTTGGCCATCGCCTGGTCGCACAG
TAAAACCTTAAATAAGGATTACATTCACGAAATTGAAGACCAGCTAGAAAAGTATTCTAAAATTGATAAA
AAACAAAATACTGCAGTGCGAGACTGGCACAACCTCGCCTTAAAACTAAACCTACTGCGAGACTTACCCA
CAGGCTATATGCTTAAAGATAGCCAATATACCTTTAAACAGGGTTTTGGTTTATACCAAGGTAACAAGTT
AGGTGAACAAGCCGAAACCACCTATAAAAAAGCGCTCGAATCGTTTTTTATGCAGCACTTAGAAGAAATG
CTAGGCGAACAGCTTGAGCTTGCTAAAAATGACGATGAGCGACTGTACGAAGCCCTTAAGTTCTACTTAA
TGCCCTACCACTCCAGCAAAATGGATACAGACAGTTTTACCTTATGGGTAAACATTCTATGGGAGCGCCA
ACTACCTAATCAAAACAAGCAAGTTTTATTAAGTGAGTTAAATAGCCACCTTAAAACTGCGCTAAGCGAA
AAAGTATCCCCGTTTCCTATCGACGACACTAAAGTCGAAATGGCCCGTAACATACTTATAAAAACCCCGC
TTGATCTACGCGTATACCGACGCTTAAAAAATGATTACATGGATCTTCATCCAGAAGAGTTTTCGATCAA
AAGCGTATTAGGCAAAAAAGCAGATGCAATGTTTTATAGAAAAAGTGGAAAGGCTCTTGAAAATGGCATT
CCAGAATTATTCACCTATTCTGGGTTTCATCGAGGGTTTAACTTAGAGAACATTAAATTATCGCAACGCC
TAGCCGATGAACAATGGATTTATGGCGACAAACAAGAAGAGGCGCTTACTGAAGAGCGCATAAAAGAAAT
AAGCAGCAGAGTAAACCAATATTACTTTAACGAGTATATTGCGCGCTGGGATGAATACCTAAACGATGTA
GCTATTCAATCGTTTGGCACCGTTAACCGAGGCCAATCTGTGGTGCAAATGCTTGCCAGCTCTGACCAAC
CGCTGGTTAAACTGCTTGTTCAAATTCGCAAACATACCGCACTAAGCGAAGCGCCTGTTATTAGCGACAA
CATGAAAGATTCCGCTAACCAATTAGCTGAAGAATTTTCCAGCAGTCAAAAAGGTAGACTCGAACGGTTA
GTGCCAAAATCTGCGGGGCTTAGTAATATAAAACTCCCCGGCTTCGACGTAACCGAGCATTTCGAAGACC
TAAACAGCTATATAAATACTGAAGAAGGCCTGCCTTTACTGCAGTTACAGCAAGCTTTAATTAATTTAGA
CGACTACTTTCAAAACTTAGCTTATTCTGAAAACACCAAACAAGCCGCATTTGACGCTAGTAAAGAATGG
AAAGGTGGCAGCAGCCCTGTTGTATTTGTACAGCGCGCTATATCCGATGCACCACCTCAAATTGAAACTT
GGTTCTCATCTATTGCAAGAGATACCGCGCAGGTTACCGCAGCAGCTACCCAAAGCCATATGAATAATAT
TTGGCAAACAGAGGTTGTGAGTTTTTATAATCGTGCGATTAAAGATAAATACCCCTTAAACCCAAAAAGT
AAGCGTGATGTTAAACTAGCAGACTTCACAAAATTTTTTGGCCCCGCCGGCATATTAGATTCCTACTTTG
TGGAATATATAGAACCCTTTGTAGACACATCTAAACACCCGTGGCGCTGGAAGAAAAATATAGGCCTTAG
CACAAACAGCCTAGAACTTTTTTATCAAGCCCAAAACATTAAAAATGCCTACTTCTCGGATAAAAGCGGC
GAACCAGAAGTTGCATTCTCGATGAAGCCGCACACACTCGACCATATTGCCAGTGGCTTTTTACTAGAAA
CAGCAGGTACCACTATCGCCTACAATCACGGCCCAGTGCGCAATGTAAATGTACTATGGCCTGGCGCAAA
AACAGACCTATCTAAAATTGTTTTTAGCCTGTCCAGTAAAGGCACCCCAATTAGCGCTCGCACCGAAGGC
GAGTGGAGCTGGTTTAGACTGCTAGACGAACACAGCAAGATAGAACGCAAGAAAGAATCCGACGGATTAT
TGGTTACTTTTGAACTGGATGGAATTGCTTCGGCTTATATCATTCAGCCCGCAAGTACCGACAACCCTTA
CCATAATAAAGATGTGCAAAAGTTTAGCTTGCCCACACAGCTGTAA
 Primer design