SecReT6
Protein ID: 91209287
SecReT6 ID120
T6SS typei1
Gene symbol-
Locus tagUTI89_C0239
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]245295..248762 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ1RFX2
KEGG IDeci:UTI89_C0239
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.40E-83, Aligned region: 487..800
ImcF-related_N [PF14331], Evalue: 9.80E-60, Aligned region: 190..437
ImcF-related_N [PF14331], Evalue: 9.80E-60, Aligned region: 817..863
DUF1215 [PF06744], Evalue: 3.90E-32, Aligned region: 285..303
DUF1215 [PF06744], Evalue: 3.90E-32, Aligned region: 896..1014
Protein Sequence: 1155 a.a.     [Download]
>gi|91209287|ref|YP_539273.1| hypothetical protein UTI89_C0239 [Escherichia coli UTI89]
MPRFKVSATWLLTLAWIFLLVWIWWQGPKWTLYEQHWLAPLANRWLATAVWGLIALVWLTWRVMKRLQKL
EKQQKQQREEEKDPLTVELHRQQQYLDHWLLRLRRHLDNRRYLWQLPWYMVIGPAGSGKSTLLREGFPSD
IVYTPESIRGVEYHPLITPRVGNQAVIFDVDGVLTTPGGDDLLRRRLREHWLGWLMQTRARQPLNGLILT
LDLPDLLTADKSRRETLVQNLRQQLQEIRQSLHCRLPVYVVLTRLDLLNGFAALFHSLDKKDRDAILGVT
FTRRAHESDGWRSELGAFWQTWVQQVNLALSDLVLAQTGAAPRSAVFSFSRQMQGTGEIVTALLAALLDG
ENMDVMLRGVWLTSSLQRGQVDDIFTQSAARQYGLGNSSLATWPLVETTPYFTRRLFPEVLLAEPNLAGE
NSVWLNSSRRRLTAFSTCGAALAALMVGSWHHYYNQNWQSGVNVLAQAKAFMDVPPPQGTDEFGNLQLPL
LNPVRDATLAYGDYRDHGFLADMGLYQGARVGPYVEQTYIQLLEQRYLPSLMNGLIRDLNIAPPESEEKL
AVLRVVRMMEDKSGRNNEAVKQYMARRWSNEFHGQRDIQAQLMVHLDYALEHTDWHAQRQSSDSDAVSRW
TPYDKPIINAQQELSKLPIYQRVYQTLRTKALSVLPADLNLRDQVGPTFDNVFVAGNDEKLVIPQFLTRY
GLQSYFVKQREGLVELTALDSWVLNLTQSVAYSEADREEIQRHITEQYISDYTATWRAGMDNLNVRDYEA
MSALTDALEQIISGDQPFQRALTALRDNTHALTLSGKLDDKAREAAINEMDYRLLSRLGHEFAPENSALE
EQKDKASTLQAVYQQLTELHRYLLAIQNSPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWV
GKLADQAWHVVMVEAVRYMEVDWRDNVVKPFNEQLADNYPFNPRATQDASLDSFERFFKPDGILDNFYKN
NLRLFLENDLTFGDDGRVLIREDIRQQLDTAQKIRDIFFSQQNGLGAQFAVETVSLSGNKRRSVLNLDGQ
LVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGRAPRSIAFSGPWAQFRLFGAGQLTNVTSDTFNVRF
NVDGGAMVYQVHVDTEDNPFTGGLFSLFRLPDTLY
 
Nucleotide Sequence: 3468 bp     [Download]
>gi|91209055|ref|NC_007946.1|:c248762-245295 Escherichia coli UTI89 chromosome, complete genome
ATGCCGCGGTTTAAAGTTTCCGCCACCTGGCTACTGACGCTGGCATGGATTTTTCTGCTGGTGTGGATCT
GGTGGCAGGGTCCAAAATGGACGCTCTATGAGCAGCACTGGCTGGCTCCGCTGGCAAACCGCTGGCTGGC
GACCGCCGTCTGGGGACTTATCGCTCTGGTCTGGCTCACCTGGCGGGTGATGAAGCGTCTGCAAAAGCTG
GAAAAACAGCAGAAACAGCAGCGGGAGGAAGAAAAAGATCCGTTGACCGTGGAACTCCACCGCCAGCAGC
AATATCTGGATCACTGGCTGCTGCGCCTGCGCCGCCATCTGGATAACCGCCGTTATCTGTGGCAGTTGCC
GTGGTATATGGTCATTGGTCCTGCGGGTAGCGGCAAAAGCACGCTGCTGCGCGAGGGCTTTCCGTCTGAC
ATTGTTTACACGCCGGAAAGCATCCGGGGTGTGGAATACCACCCGCTGATCACACCGCGAGTGGGCAACC
AGGCGGTAATTTTCGATGTTGACGGCGTACTGACCACTCCCGGCGGGGATGATCTGCTCCGCCGCCGCCT
GCGCGAACACTGGCTGGGCTGGCTGATGCAAACGCGCGCTCGCCAGCCGCTCAACGGTCTTATCCTGACG
CTCGATCTTCCCGATCTGCTGACGGCGGATAAATCCCGCCGTGAGACACTGGTACAAAATTTGCGCCAGC
AACTTCAGGAGATCCGTCAGAGCCTGCACTGCCGTCTGCCCGTTTACGTGGTGCTGACACGGCTGGATCT
GCTGAACGGCTTTGCCGCGCTGTTCCATTCACTGGATAAAAAAGACCGCGATGCGATCCTCGGCGTCACA
TTTACCCGCCGCGCCCATGAAAGTGACGGCTGGCGCAGCGAACTGGGGGCTTTCTGGCAGACGTGGGTAC
AACAGGTGAACCTGGCGCTGTCGGATCTGGTGCTCGCACAAACCGGTGCTGCTCCCCGCAGCGCTGTGTT
CAGCTTCTCCCGTCAGATGCAGGGAACAGGAGAAATCGTCACCGCACTGCTCGCCGCATTGCTGGACGGT
GAGAACATGGATGTAATGCTGCGTGGCGTCTGGCTCACATCCTCGCTACAGCGTGGCCAGGTGGATGATA
TTTTCACGCAGTCCGCCGCCCGCCAGTACGGACTGGGTAACAGCTCGCTGGCAACCTGGCCTCTGGTGGA
GACGACGCCGTATTTTACTCGCCGCCTCTTCCCGGAAGTCCTGCTGGCTGAGCCGAACCTGGCGGGTGAA
AACAGCGTCTGGCTGAACAGCTCCCGGCGCAGGCTGACCGCCTTTTCCACCTGTGGCGCGGCACTGGCGG
CATTGATGGTCGGAAGCTGGCACCATTATTACAATCAGAACTGGCAGTCTGGCGTTAACGTACTGGCACA
AGCTAAAGCCTTTATGGACGTACCACCACCGCAGGGAACGGATGAATTCGGCAATCTGCAATTGCCATTG
CTTAACCCGGTACGCGATGCCACCCTGGCCTATGGTGATTATCGCGATCACGGTTTTCTGGCGGATATGG
GATTGTACCAGGGCGCCCGCGTAGGGCCGTATGTGGAGCAAACCTACATTCAGCTTCTTGAGCAGCGTTA
TCTCCCCTCGTTAATGAACGGCCTGATCCGGGATCTAAACATTGCCCCGCCAGAGAGCGAAGAAAAGCTC
GCTGTGCTGCGCGTAGTGCGCATGATGGAAGACAAAAGTGGGCGCAACAACGAGGCGGTAAAACAGTACA
TGGCACGGCGCTGGAGCAATGAATTTCACGGCCAGCGCGATATTCAGGCGCAACTGATGGTGCATCTGGA
CTATGCGCTGGAGCACACCGACTGGCACGCGCAGCGCCAAAGCAGCGACAGCGATGCTGTCAGCCGCTGG
ACCCCCTATGATAAACCGATCATTAATGCGCAGCAGGAACTGAGCAAGCTGCCCATATACCAGCGTGTCT
ACCAGACCCTGCGCACCAAAGCATTAAGCGTGTTGCCCGCCGATTTGAATTTGCGCGACCAGGTTGGTCC
CACCTTCGACAACGTGTTCGTCGCCGGTAATGATGAAAAACTGGTGATCCCGCAGTTCCTCACCCGCTAT
GGACTGCAAAGCTATTTTGTCAAACAGCGTGAGGGCCTCGTTGAGCTGACCGCGCTGGATTCGTGGGTAC
TGAACCTGACGCAAAGCGTCGCCTACAGCGAGGCCGACCGTGAAGAGATCCAGCGCCATATCACCGAACA
GTACATCAGTGACTATACCGCCACCTGGCGTGCCGGAATGGATAACCTCAACGTCCGTGACTATGAGGCC
ATGTCGGCGCTGACCGACGCGCTGGAGCAGATTATCAGCGGCGATCAGCCATTCCAGCGTGCGCTGACGG
CGCTGCGCGATAATACCCACGCGCTGACGCTCTCCGGCAAACTGGATGATAAGGCGAGGGAAGCGGCGAT
AAATGAGATGGATTACCGCCTGTTATCCCGGCTGGGGCATGAGTTCGCACCGGAAAACAGCGCACTGGAG
GAGCAAAAGGACAAGGCGAGTACGCTACAGGCCGTGTACCAGCAACTGACCGAGCTGCACCGTTACCTGC
TGGCGATCCAGAACTCGCCAGTGCCGGGGAAATCGGCGCTGAAAGCAGTACAGCTACGGCTGGATCAAAA
CAGCAGCGATCCAATCTTCGCCACCCGTCAGATGGCAAAAACCCTGCCTGCGCCTCTTAACCGCTGGGTA
GGTAAGCTCGCGGATCAGGCCTGGCATGTGGTGATGGTGGAAGCCGTTCGTTACATGGAAGTGGACTGGC
GCGACAATGTAGTGAAACCCTTCAACGAGCAGCTTGCCGATAACTATCCGTTTAATCCGCGCGCCACACA
GGATGCCTCACTGGATTCGTTTGAACGTTTCTTTAAACCGGATGGCATTCTGGACAATTTCTACAAGAAC
AACCTGCGCCTGTTCCTTGAAAACGATCTGACCTTTGGCGACGACGGCAGAGTGTTAATCCGTGAAGATA
TCCGGCAGCAACTGGATACCGCGCAGAAAATCCGCGACATCTTCTTCAGCCAGCAGAACGGGCTGGGCGC
ACAGTTTGCCGTGGAAACCGTATCGCTTTCCGGCAATAAGCGGCGCAGCGTACTTAACCTGGACGGCCAG
TTAGTGGACTACAGCCAGGGACGCAACTACACCGCCCATCTGGTCTGGCCGAACAACATGCGTGAAGGCA
ATGAAAGCAAGCTGACGCTGATTGGCACCAGCGGCAGAGCACCGCGCAGTATCGCGTTCAGTGGACCGTG
GGCGCAGTTCCGCCTGTTCGGCGCGGGCCAGTTGACCAATGTGACCAGTGACACCTTTAACGTGCGCTTT
AACGTGGACGGCGGCGCAATGGTTTACCAGGTGCATGTGGATACCGAAGATAACCCGTTCACCGGCGGTC
TGTTCAGCCTGTTCCGTTTACCGGATACGTTGTATTAA
 Primer design