SecReT6
Protein ID: 91212184
SecReT6 ID121
T6SS typei2
Gene symbol-
Locus tagUTI89_C3190
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]3102641..3103162 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ1R7M5
KEGG IDeci:UTI89_C3190
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.00E-52, Aligned region: 13..165
Protein Sequence: 173 a.a.     [Download]
>gi|91212184|ref|YP_542170.1| hypothetical protein UTI89_C3190 [Escherichia coli UTI89]
MDDEEKDMADSFQNEVPTARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKVDINKNNF
NSVMAEFSPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDN
ATFRRELENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 522 bp     [Download]
>gi|91209055|ref|NC_007946.1|:3102641-3103162 Escherichia coli UTI89 chromosome, complete genome
GTGGATGATGAGGAAAAGGATATGGCTGACAGTTTCCAGAATGAAGTTCCCACCGCTCGTGTAAATATCA
AGCTTGATCTGCATACAGGCAATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCCGTAGGCGA
TTACAGTAACGGAAAAGAGCAACGTCCGCTGTCCGAACGGGACAAGGTTGATATCAATAAAAACAACTTC
AACAGCGTCATGGCTGAGTTTTCGCCTGCGGTTAATTTAACAGTAGAAGATACGCTAAACGGAAACGGTA
ATGAACAAAATATCGCGCTTGAATTTAAAAGCCTGAAGGATTTTGAACCCGAACAGGTAGCAAAAAATAT
TCCGCAACTTCGTGTATTACTCGCTATGCGCAATTTACTACGTGACCTGAAATCCAATCTGCTGGATAAC
GCAACGTTTCGCCGTGAACTGGAAAATATTCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAAC
TGGCGAAAATTGCGCCGCAGGAGAACGTTTAA
 Primer design