SecReT6
Protein ID: 91212194
SecReT6 ID121
T6SS typei2
Gene symbol-
Locus tagUTI89_C3200
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]3116083..3116916 [+]
Producthypothetical protein
NoteTli4 (i)
UniProt IDQ1R7L5
KEGG IDeci:UTI89_C3200
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 277 a.a.     [Download]
>gi|91212194|ref|YP_542180.1| hypothetical protein UTI89_C3200 [Escherichia coli UTI89]
MVKCHTLINRRNKCLLIVFIVLIGWIIFRPKAYTYSLNDKEKEMLIMLSQHPETRYFGFYSIELPADYKP
TGMVMFIQGSAMIPVETKLQYYPPFLQYMTRYEAELKNTSALDPLDTPYLKQVHPLSPPMNGVIFERMKA
KYTPDFARVLDAWKWENGVTFSVKIEAKDGRATRYDGISKIAEYSYGYNIPEKKVQLLTILSGLQPRADN
QPPSENKLAIQYAQVDASLLGEYELSVDYKNSNNIKISLQTDNNSYIDSLLDIRYPSNGNRAWYNSI
 
Nucleotide Sequence: 834 bp     [Download]
>gi|91209055|ref|NC_007946.1|:3116083-3116916 Escherichia coli UTI89 chromosome, complete genome
ATGGTAAAATGTCATACTCTGATTAACCGTAGAAATAAATGTCTGCTGATTGTTTTTATAGTCCTTATTG
GATGGATTATATTCAGACCTAAAGCATATACTTATTCACTAAATGATAAAGAAAAAGAGATGCTCATAAT
GTTATCACAACATCCTGAAACTCGGTACTTTGGATTTTATTCCATAGAACTTCCGGCTGATTACAAACCA
ACAGGAATGGTTATGTTCATACAAGGATCGGCGATGATCCCTGTAGAAACAAAGCTACAATATTATCCTC
CTTTTCTGCAATATATGACACGATATGAGGCAGAACTAAAAAACACCTCAGCATTAGATCCACTGGATAC
GCCTTATTTGAAGCAAGTTCACCCACTAAGTCCACCTATGAATGGAGTCATTTTTGAACGAATGAAAGCG
AAATACACCCCAGATTTTGCACGAGTATTGGATGCATGGAAATGGGAAAATGGCGTTACGTTTTCAGTAA
AAATAGAAGCTAAAGATGGTAGAGCAACCCGCTATGATGGAATTAGTAAGATTGCCGAATACAGTTATGG
ATATAATATTCCAGAAAAAAAAGTACAGTTACTTACTATTCTTTCAGGACTACAACCTCGTGCAGATAAC
CAACCCCCATCAGAAAATAAATTGGCGATACAATATGCACAGGTTGACGCTTCACTACTTGGAGAGTATG
AATTATCTGTAGATTATAAAAATAGCAATAATATTAAAATAAGTTTGCAGACGGATAATAATAGTTATAT
TGACTCATTATTAGATATAAGATATCCGAGTAATGGAAACAGAGCATGGTATAACTCTATATAA
 Primer design