SecReT6
Protein ID: 91212196
SecReT6 ID121
T6SS typei2
Gene symbol-
Locus tagUTI89_C3202
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]3117642..3117902 [+]
Producthypothetical protein
NotePAAR
UniProt IDQ1R7L3
KEGG IDeci:UTI89_C3202
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.20E-22, Aligned region: 7..78
Protein Sequence: 86 a.a.     [Download]
>gi|91212196|ref|YP_542182.1| hypothetical protein UTI89_C3202 [Escherichia coli UTI89]
MPGIVCLGDATTHGGKVITATSTLFINGIQVALVGDLVSCPKHGVNPIQEGDPTATEKGRNVVVNHCQCA
CGCRVISSQPENSIES
 
Nucleotide Sequence: 261 bp     [Download]
>gi|91209055|ref|NC_007946.1|:3117642-3117902 Escherichia coli UTI89 chromosome, complete genome
ATGCCTGGGATCGTTTGTTTAGGTGATGCCACGACTCATGGTGGTAAGGTGATTACCGCAACTTCAACGC
TTTTTATCAATGGCATTCAGGTAGCTCTCGTAGGTGATCTGGTTTCCTGCCCAAAGCACGGCGTGAATCC
CATACAAGAAGGTGACCCGACAGCGACGGAAAAAGGTCGTAATGTCGTTGTTAATCATTGCCAATGTGCA
TGTGGCTGTAGGGTTATCAGTTCTCAACCAGAAAATAGTATCGAGTCATAA
 Primer design