SecReT6
Protein ID: 91212202
SecReT6 ID121
T6SS typei2
Gene symbol-
Locus tagUTI89_C3208
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]3130072..3130608 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ1R7K7
KEGG IDeci:UTI89_C3208
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.10E-36, Aligned region: 19..168
Protein Sequence: 178 a.a.     [Download]
>gi|91212202|ref|YP_542188.1| hypothetical protein UTI89_C3208 [Escherichia coli UTI89]
MFPIRFKRPALLCMAMLTVVLSGCGLIQKVVDESKSVASAVFYKQIKILHLDFFSRSALNTDAEDTPLST
MVHVWQLKTREDFDKADYDTLFMQEEKTLEKDVLAKHTVWVKPEGTASLNVPLDKETQFVAIIGQFYHPD
EKSDSWRLVIKRDELEADKPRSIELMRSDLRLLPLKDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|91209055|ref|NC_007946.1|:3130072-3130608 Escherichia coli UTI89 chromosome, complete genome
ATGTTTCCTATTCGTTTTAAACGTCCGGCGTTGCTCTGTATGGCGATGCTGACGGTTGTTCTGAGTGGCT
GCGGGCTGATTCAGAAAGTGGTGGATGAATCGAAAAGCGTGGCCTCAGCCGTTTTCTACAAACAAATCAA
AATACTGCATCTCGATTTCTTCTCCCGCAGCGCCCTGAATACGGATGCGGAAGATACGCCGCTTTCCACG
ATGGTGCATGTCTGGCAACTGAAAACCCGCGAAGATTTTGACAAGGCGGATTACGACACCCTGTTTATGC
AGGAAGAGAAGACGCTGGAGAAGGACGTACTGGCAAAACACACCGTCTGGGTAAAACCGGAAGGCACGGC
ATCCCTGAATGTGCCGCTGGATAAAGAGACGCAGTTTGTCGCCATTATTGGGCAGTTTTATCACCCTGAT
GAAAAAAGCGACAGCTGGCGTCTGGTGATCAAAAGGGACGAACTGGAGGCCGACAAGCCGCGCTCGATTG
AACTGATGAGAAGCGACCTGCGACTGCTGCCTCTCAAGGATAAATAA
 Primer design